Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0706 (MJ0706)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1–1.0 mg/mL. For long-term storage, we recommend adding 5–50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
MJ0706; Uncharacterized protein MJ0706
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0706
Target Protein Sequence
MRDAYLMMVLMDALKEIFDLKEILKSPIRNKKVILFVSLVFILSLVLLYILVVNIKYFSY LGDIIFQNFQKHVENLKITLNEDNLHIILAIWKNNLTVCILNYILGIFSLFVIAVNSYIL SYVLYKFGAESFIYLVLPHGIIEIPALILSASGGVLFNMGLVNFLINIKFGTKREVLYYI KESLKLLILSIILFIVAGIVEGTITFKIAKIMFS
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0706

STRING: 243232.MJ_0706

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MJ0706 and why is it significant for research?

MJ0706 is an uncharacterized protein from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440), formerly known as Methanococcus jannaschii. The significance of studying this protein lies in understanding the structural and functional properties of proteins from hyperthermophilic methanogens, which can provide insights into archaeal biology, protein evolution, and potential biotechnological applications. As a protein from an organism that thrives at extreme temperatures (optimal growth at 80°C), MJ0706 may possess unique structural features that contribute to thermostability, making it valuable for both basic research and potential biotechnological applications .

What are the optimal storage conditions for recombinant MJ0706 protein?

The recombinant MJ0706 protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for regular use. For long-term storage, it is recommended to keep the protein at -80°C. To minimize protein degradation, avoid repeated freeze-thaw cycles. It is advisable to prepare small working aliquots that can be stored at 4°C for up to one week . When handling the protein, ensure minimal exposure to room temperature to preserve its structural integrity and activity. Documentation of freeze-thaw cycles should be maintained to track potential degradation effects on experimental outcomes.

How can I grow M. jannaschii for isolation of native MJ0706?

M. jannaschii requires specific growth conditions due to its hyperthermophilic and methanogenic nature. The recommended protocol includes:

  • Use medium 1 supplemented with a H₂ and CO₂ mixture (80:20, v/v) as methanogenesis substrates.

  • Cultivate cells in sealed serum bottles (160 or 530 ml) containing 10 or 200 ml of anaerobic medium, respectively.

  • Pressurize the headspace with H₂ and CO₂ mixture to 3 × 10⁵ Pa.

  • Incubate cultures at 80°C with shaking at 200 rpm.

  • Monitor growth by measuring optical density at 600 nm .

For solid media preparation:

  • Use medium 3 (medium 1 without MgCl₂·6H₂O and CaCl₂·2H₂O) with 0.7% Gelrite®.

  • After autoclaving, add MgCl₂, CaCl₂, Na₂S, cysteine, and yeast extract to final concentrations of 38 mM, 2.45 mM, 2 mM, 2 mM, and 0.1%, respectively.

  • Pour the medium onto glass petri dishes inside an anaerobic chamber.

  • After inoculation, place plates in an anaerobic canister pressurized with H₂ and CO₂.

  • Include Na₂S solution to maintain reducing conditions .

It's important to note that M. jannaschii fails to grow on solid medium without additional reducing agents even when sulfide is provided.

What approaches can be used for crystallization and structural determination of MJ0706?

Based on successful strategies with other M. jannaschii proteins, the following approach is recommended for MJ0706 crystallization and structural determination:

  • Protein preparation:

    • Express MJ0706 as a His-tagged fusion protein in an E. coli expression system

    • Consider creating a truncated form (e.g., removing 10-15 N-terminal residues) to improve crystallization properties

    • Purify using affinity chromatography followed by size exclusion chromatography

  • Crystallization screening:

    • Test multiple crystallization conditions with varying precipitants, buffers, and additives

    • Based on success with MJ0754, try both full-length and truncated versions of the protein

    • Optimize promising conditions by varying protein concentration, temperature, and drop size

  • Data collection and processing:

    • For phase determination, prepare selenomethionine (SeMet) labeled protein

    • Collect diffraction data at synchrotron radiation facilities

    • Process data using appropriate software packages (XDS, HKL2000, etc.)

  • Structure solution and refinement:

    • Use experimental phasing methods (SAD/MAD) with SeMet-labeled crystals

    • Build and refine the model using standard crystallographic software

    • Validate the final structure using MolProbity or similar tools

This approach is supported by the successful crystallization of MJ0754, which yielded high-resolution structures (up to 1.3 Å) when appropriate conditions were identified .

How can I design a genetic system to study MJ0706 function in vivo?

To study MJ0706 function in vivo, you can establish a genetic system in M. jannaschii using the following approach:

  • Vector construction:

    • Develop a suicide vector similar to pDS261 used for other M. jannaschii genes

    • Include homologous flanking regions for targeted integration

    • Add selectable markers suitable for M. jannaschii (e.g., mevinolin resistance)

    • Consider including epitope tags (e.g., 3xFLAG-Twin Strep tag) for protein detection and purification

  • Transformation protocol:

    • Grow M. jannaschii cells at 65°C until mid-log phase (OD600 of 0.5-0.7)

    • Harvest cells by centrifugation inside an anaerobic chamber

    • Resuspend cells in pre-reduced medium containing sodium sulfide

    • Incubate at 4°C for 30 minutes

    • Add linearized plasmid DNA (2 μg)

    • Continue incubation at 4°C for an hour

    • Apply heat shock at 85°C for 45 seconds

    • Cool at 4°C for 10 minutes

    • Transfer to pre-reduced medium supplemented with yeast extract

    • Incubate overnight at 80°C

    • Plate on selective solid medium

  • Functional analysis approaches:

    • Generate knockout, knockdown, or overexpression strains

    • Compare growth phenotypes under various conditions

    • Analyze protein expression using Western blotting

    • Perform RNA-seq to identify gene expression changes

    • Use proteomics to identify interaction partners

This genetic system has been successfully applied to other M. jannaschii proteins and can be adapted for MJ0706 functional studies.

What techniques are recommended for analyzing potential membrane association of MJ0706?

Based on sequence analysis suggesting possible transmembrane domains in MJ0706, the following techniques are recommended to analyze its membrane association:

  • Computational prediction:

    • Use multiple transmembrane prediction algorithms (TMHMM, Phobius, MEMSAT)

    • Analyze hydrophobicity plots and amphipathicity

    • Compare with known membrane proteins from archaea

  • Biochemical fractionation:

    • Separate soluble and membrane fractions from M. jannaschii cells

    • Use ultracentrifugation to isolate different membrane types

    • Detect MJ0706 in fractions using specific antibodies or mass spectrometry

    • Test extraction with different detergents and chaotropic agents

  • Fluorescence microscopy:

    • Express fluorescently tagged MJ0706 in heterologous systems

    • Use membrane-specific dyes for colocalization studies

    • Analyze distribution patterns in live cells

  • Biophysical techniques:

    • Circular dichroism spectroscopy in the presence of lipid vesicles

    • Differential scanning calorimetry to assess protein-lipid interactions

    • FRET analysis with lipid-specific probes

  • Reconstitution studies:

    • Incorporate purified MJ0706 into proteoliposomes

    • Assess structural integrity and functionality in the lipid environment

    • Compare properties in different lipid compositions mimicking archaeal membranes

Each approach provides complementary information about the membrane association properties of MJ0706, which is essential for understanding its cellular localization and function.

How can mass spectrometry be utilized for post-translational modification analysis of MJ0706?

For comprehensive post-translational modification (PTM) analysis of MJ0706, the following mass spectrometry-based approach is recommended:

  • Sample preparation:

    • Purify MJ0706 using affinity chromatography (e.g., His-tag purification)

    • Perform in-solution or in-gel digestion with multiple proteases (trypsin, thermolysin, chymotrypsin) to ensure complete sequence coverage

    • Enrich for specific PTMs using appropriate techniques (TiO₂ for phosphopeptides, lectin affinity for glycopeptides)

  • LC-MS/MS analysis:

    • Use an UltiMate 3000 RSLCnano system coupled to an Orbitrap mass spectrometer

    • Apply multiple fragmentation methods (HCD, ETD, CID) to improve PTM characterization

    • Implement data-dependent and data-independent acquisition strategies

  • Data analysis:

    • Search against a dedicated database for MJ0706

    • Allow for variable modifications common in archaea (methylation, acetylation, etc.)

    • Validate PTM identifications using site-determining ions and localization scores

    • Quantify PTM levels using label-free or labeled approaches

  • Validation experiments:

    • Confirm key PTMs using targeted MS approaches (PRM, MRM)

    • Generate site-specific antibodies for important modifications

    • Perform site-directed mutagenesis to assess functional significance

This comprehensive approach has been successfully applied to other M. jannaschii proteins, such as FprA, providing insights into their post-translational regulation and structural features .

What is the recommended protocol for expressing and purifying recombinant MJ0706?

Based on successful approaches with other M. jannaschii proteins, the following protocol is recommended for expressing and purifying recombinant MJ0706:

Expression system selection:

  • E. coli BL21(DE3) or Rosetta(DE3) strains for high-level expression

  • Consider codon optimization for archaeal genes expressed in E. coli

  • For challenging expression, try cell-free systems or alternative hosts (e.g., yeast)

Vector design:

  • Use pET vectors with T7 promoter for E. coli expression

  • Include His-tag or other affinity tags (Strep-tag, FLAG) for purification

  • Consider a cleavable tag with TEV or PreScission protease site

Expression conditions:

  • Transform expression host with the construct and select on appropriate antibiotics

  • Grow cultures at 37°C until OD600 reaches 0.6-0.8

  • Induce with IPTG (0.1-1.0 mM) at reduced temperature (18-25°C) for 4-16 hours

  • For thermostable proteins like MJ0706, a heat treatment step (60-70°C) can be included after cell lysis to remove E. coli proteins

Purification protocol:

  • Resuspend cells in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, protease inhibitors)

  • Lyse cells using sonication or high-pressure homogenization

  • Clarify lysate by centrifugation (20,000 × g, 30 min, 4°C)

  • Apply supernatant to Ni-NTA resin or IMAC column

  • Wash with increasing imidazole concentrations (20-50 mM)

  • Elute with high imidazole (250-300 mM)

  • Perform size exclusion chromatography for final polishing

  • Store in Tris-based buffer with 50% glycerol at -20°C

Quality control:

  • Assess purity by SDS-PAGE and protein concentration by Bradford or BCA assay

  • Verify identity using Western blot and mass spectrometry

  • Evaluate oligomeric state using native PAGE or analytical SEC

What are the considerations for designing functional assays for an uncharacterized protein like MJ0706?

When designing functional assays for an uncharacterized protein like MJ0706, consider the following systematic approach:

  • Bioinformatic analysis to guide hypothesis generation:

    • Sequence homology and conserved domains

    • Structural prediction and comparison with characterized proteins

    • Genomic context and potential operon structures

    • Phylogenetic distribution and evolutionary conservation

  • General biochemical activity screening:

    • ATPase/GTPase activity assays

    • Nucleic acid binding assays (DNA, RNA)

    • Lipid binding/modification assays

    • Redox activity tests

    • Enzymatic reactions common in archaeal metabolism

  • Context-specific functional tests:

    • Based on the transmembrane prediction, investigate:

      • Ion transport assays using liposomes

      • Membrane integrity tests

      • Protein-protein interactions with other membrane components

  • In vivo functional assessment:

    • Phenotypic analysis of knockout/overexpression strains

    • Localization studies using fluorescent tags

    • Transcriptomic/proteomic analysis of genetic variants

    • Stress response analysis (temperature, pH, oxidative stress)

  • Design controls:

    • Include positive controls (known proteins with similar predicted functions)

    • Use negative controls (denatured protein, buffer-only)

    • Generate mutant versions targeting predicted functional residues

    • Test activity under varying conditions (temperature, pH, salt, cofactors)

A systematic combination of these approaches provides the best chance of elucidating the function of an uncharacterized protein like MJ0706, particularly given its archaeal origin and potential novel functional properties.

How can I adapt crystallization conditions for hyperthermophilic proteins like MJ0706?

Crystallizing hyperthermophilic proteins like MJ0706 presents unique challenges and opportunities. The following adaptations are recommended:

  • Temperature considerations:

    • Screen crystallization conditions at both room temperature and elevated temperatures (37-45°C)

    • Consider that hyperthermophilic proteins may adopt different conformations at different temperatures

    • Use temperature-controlled crystallization incubators for consistent results

  • Buffer and pH optimization:

    • Test wider pH ranges (pH 4-9) as hyperthermophilic proteins often have shifted pH optima

    • Use buffers with minimal temperature-dependent pH shifts (e.g., HEPES, MOPS)

    • Include thermostable additives that mimic the cellular environment of M. jannaschii

  • Crystal growth modifications:

    • Try seeding techniques to overcome nucleation barriers

    • Use oil barriers to slow vapor diffusion rates

    • Consider crystallization under high-pressure conditions to mimic native environment

  • Protein preparation adjustments:

    • Maintain higher salt concentrations in protein storage buffers

    • Include stabilizing agents like glycerol or trehalose

    • Test both oxidizing and reducing conditions for optimal stability

  • Screening strategy:

    • Create a customized sparse matrix focusing on conditions successful for other archaeal proteins

    • Include specific ions abundant in hyperthermophilic environments (e.g., potassium, magnesium)

    • Test both vapor diffusion and microbatch methods

Based on the success with MJ0754, consider preparing both full-length and truncated versions of MJ0706, as the truncated version of MJ0754 (residues 11-185) yielded higher resolution diffraction (1.3 Å) compared to the full-length protein (3.1 Å) .

What comparative analysis approaches can reveal insights about MJ0706 function?

To gain insights into the potential function of MJ0706, comprehensive comparative analysis approaches can be employed:

  • Sequence-based comparisons:

    • Perform BLAST and HMM searches against multiple databases

    • Use position-specific scoring matrices to identify distant homologs

    • Analyze conservation patterns across archaeal and bacterial domains

    • Apply feature extraction algorithms to identify functional motifs

  • Structural comparison approaches:

    • Generate homology models using multiple templates

    • Perform structure-based similarity searches using DALI or PDBeFold

    • Analyze protein surface properties (electrostatics, hydrophobicity)

    • Identify potential ligand-binding pockets and compare with known structures

  • Genomic context analysis:

    • Examine gene neighborhood conservation across species

    • Identify potential operons or functional gene clusters

    • Analyze coevolution patterns with other genes

    • Map conservation onto metabolic pathway frameworks

  • Expression pattern correlation:

    • Compare expression profiles across different conditions

    • Identify genes with similar expression patterns

    • Analyze proteomics data for co-occurrence in protein complexes

    • Examine differential expression under stress conditions

  • Phylogenetic profiling:

    • Create presence/absence matrices across diverse species

    • Identify co-evolving protein families

    • Map distributions across evolutionary trees

    • Correlate with specific environmental adaptations

These complementary approaches can collectively generate testable hypotheses about MJ0706 function, particularly when integrated with experimental validation strategies .

How should experimental conditions be modified when working with recombinant MJ0706?

When designing experiments with recombinant MJ0706, consider these modifications to standard protocols:

  • Temperature adjustments:

    • Perform activity assays at elevated temperatures (60-80°C) to match native conditions

    • Use thermal-stable equipment (heated plates, thermostable cuvettes)

    • Include temperature gradient studies to determine optimal activity range

    • Pre-heat buffers and reaction components before adding the enzyme

  • Buffer composition optimization:

    • Use buffers with minimal temperature-dependent pH shifts

    • Consider higher ionic strength to maintain protein stability

    • Test the effect of various divalent cations (Mg²⁺, Mn²⁺, Ca²⁺)

    • Include reducing agents to maintain cysteine residues in reduced state

  • Stability considerations:

    • Add stabilizing agents (glycerol, trehalose) to prevent aggregation

    • Minimize freeze-thaw cycles by preparing single-use aliquots

    • Consider protein engineering approaches for difficult experiments

    • Monitor protein stability over time under experimental conditions

  • Control experiments:

    • Include thermoactive positive controls from same organism

    • Test activity of heat-denatured MJ0706 as negative control

    • Perform parallel experiments with mesophilic homologs if available

    • Include buffer-only controls pre-incubated at high temperatures

The table below summarizes the recommended modifications for different experimental techniques:

TechniqueStandard ConditionModified Condition for MJ0706Rationale
Enzymatic assays25-37°C, pH 7.460-80°C, pH 6.0-7.0Match native environment
Protein storage-20°C in buffer-20°C in 50% glycerolPrevent freezing damage
Protein-protein interactionRoom temperature50-60°CNatural conformational state
Crystallization4-20°C20-37°CPhysiologically relevant structure
Circular dichroism20°C20°C and 60-80°CCompare folding at different temperatures

What strategies can overcome challenges in functional characterization of MJ0706?

Functional characterization of uncharacterized proteins like MJ0706 presents several challenges that can be addressed using these strategies:

  • Challenge: No known functional annotations

    • Strategy: Implement activity-based protein profiling

      • Use chemically reactive probes to identify catalytic residues

      • Perform substrate screening using metabolite libraries

      • Apply thermal shift assays with potential substrates/cofactors

      • Develop computational predictions based on structural features

  • Challenge: Potential membrane association

    • Strategy: Adapted membrane protein techniques

      • Use mild detergents for solubilization

      • Develop nanodiscs or liposome reconstitution systems

      • Apply label-free surface techniques (SPR, BLI)

      • Utilize fluorescence-based transport assays

  • Challenge: Extreme temperature requirements

    • Strategy: High-temperature compatible methodologies

      • Design thermostable reporter systems

      • Implement stopped-flow techniques with temperature control

      • Develop in situ activity assays at elevated temperatures

      • Use quench-flow approaches for rapid kinetic analysis

  • Challenge: Potential complex formation requirements

    • Strategy: Protein interaction mapping

      • Perform pull-down assays with M. jannaschii lysates

      • Apply chemical crosslinking followed by MS analysis

      • Use bacterial/yeast two-hybrid systems with archaeal libraries

      • Reconstitute potential complexes from purified components

  • Challenge: Unknown cellular location

    • Strategy: Multi-faceted localization approaches

      • Fractionate M. jannaschii cells under anaerobic conditions

      • Generate antibodies for immunolocalization

      • Express fluorescent protein fusions for visualization

      • Apply proteomics to purified cellular compartments

Implementing these strategies in parallel maximizes the chances of successful functional characterization while addressing the unique challenges presented by archaeal proteins from hyperthermophilic organisms.

How can molecular dynamics simulations provide insights into MJ0706 stability and function?

Molecular dynamics (MD) simulations offer valuable insights into the structure-function relationship of MJ0706, particularly regarding its thermostability. The following approach is recommended:

  • System preparation:

    • Generate a homology model of MJ0706 based on the most closely related proteins with known structures

    • Embed the protein in appropriate membrane models if transmembrane regions are predicted

    • Solvate the system using explicit solvent models and add counterions

    • Apply archaeal-specific lipid compositions for membrane simulations

  • Simulation parameters:

    • Run simulations at multiple temperatures (25°C, 60°C, 80°C, 100°C)

    • Extend simulations to microsecond timescales when possible

    • Use enhanced sampling techniques (replica exchange, metadynamics)

    • Apply appropriate force fields optimized for thermostable proteins

  • Analysis approaches:

    • Calculate root-mean-square deviation (RMSD) and fluctuation (RMSF)

    • Identify rigid domains and flexible regions

    • Analyze hydrogen bonding networks and salt bridge formation

    • Examine water penetration into the protein core

    • Perform principal component analysis to identify dominant motions

  • Specific investigations:

    • Simulate unfolding pathways at different temperatures

    • Identify stabilizing interactions unique to thermophilic proteins

    • Model potential ligand binding using docking and MD

    • Perform in silico mutagenesis to predict stabilizing mutations

MD simulations can provide atomic-level insights into the mechanisms of thermostability and potential function of MJ0706, guiding experimental design and hypothesis generation.

What mass spectrometry approaches are most effective for studying protein-protein interactions of MJ0706?

For comprehensive characterization of MJ0706 protein-protein interactions, the following mass spectrometry approaches are recommended:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged MJ0706 in M. jannaschii using the established genetic system

    • Perform pull-downs under native conditions

    • Analyze co-purified proteins using LC-MS/MS

    • Implement SILAC or TMT labeling for quantitative comparison

    • Include appropriate controls (non-specific binding, empty vector)

  • Cross-linking mass spectrometry (XL-MS):

    • Apply MS-cleavable crosslinkers to stabilize transient interactions

    • Use thermostable crosslinkers suitable for high-temperature conditions

    • Perform in vivo crosslinking in M. jannaschii cells

    • Analyze crosslinked peptides using specialized software (e.g., XlinkX)

    • Map interaction sites onto structural models

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Compare deuterium uptake of MJ0706 alone versus in complex

    • Identify binding interfaces through differential protection

    • Optimize exchange conditions for thermophilic proteins

    • Implement automated workflows to minimize back-exchange

    • Visualize results on structural models

  • Native mass spectrometry:

    • Analyze intact protein complexes under native conditions

    • Determine stoichiometry and binding affinities

    • Examine complex stability at different temperatures

    • Use ion mobility to determine collision cross sections

    • Combine with top-down fragmentation for subunit identification

  • Thermal proteome profiling (TPP):

    • Monitor thermal stability changes upon complex formation

    • Identify potential binding partners through co-stabilization

    • Implement CETSA (cellular thermal shift assay) with MS readout

    • Analyze results using specialized TPP bioinformatics tools

Each of these complementary approaches provides different information about the interactome of MJ0706, collectively building a comprehensive understanding of its functional interactions within the cellular context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.