Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0749 (MJ0749)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Methanocaldococcus jannaschii Uncharacterized Protein MJ0749 (MJ0749)

MJ0749 is a recombinant protein derived from the thermophilic archaeon Methanocaldococcus jannaschii, an extremophile isolated from deep-sea hydrothermal vents. It is classified as an uncharacterized protein, meaning its precise biological function remains unknown despite its inclusion in the organism’s fully sequenced genome . MJ0749 is produced recombinantly in heterologous systems (e.g., E. coli) for biochemical studies, often tagged with affinity markers like His-tag for purification .

Production and Recombinant Expression

MJ0749 is synthesized via recombinant DNA technology, leveraging M. jannaschii’s genetic tools . Key methods include:

StepProcess
CloningPCR amplification of MJ0749 coding sequence; insertion into expression vectors
ExpressionInduction in E. coli under optimized conditions (e.g., IPTG induction)
PurificationAffinity chromatography using His-tag
Yield50 µg per batch (typical commercial production)

The patent literature highlights M. jannaschii’s genome as a resource for recombinant protein production, emphasizing its compatibility with heterologous systems .

Research Applications and Challenges

MJ0749 serves as a model for studying:

  • Archaeal protein evolution: Comparative analysis with eukaryotic or bacterial homologs to identify conserved motifs .

  • Thermophilic biochemistry: Structural studies to elucidate thermostability mechanisms .

  • Functional genomics: High-throughput screening to assign biochemical roles .

Limitations:

  • Functional ambiguity: No assigned pathway or catalytic activity .

  • Experimental hurdles: Requires specialized handling due to M. jannaschii’s thermophilic origins .

Future Directions

MJ0749’s study aligns with broader goals in archaeal genomics:

  1. Functional annotation: CRISPR-based gene knockouts in M. jannaschii to infer roles .

  2. Structural biology: X-ray crystallography to determine tertiary structure.

  3. Biotechnological applications: Engineering thermostable variants for industrial use.

This protein exemplifies the untapped potential of archaeal genomes for discovering novel biochemical pathways .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate special format requests. Please specify your preference when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us. We will prioritize developing your preferred tag type during the production process.
Synonyms
MJ0749; Uncharacterized protein MJ0749
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0749
Target Protein Sequence
MDSRVYIIKFDNWGFMVNLMNKIQILRKISQTLFFVRALIVTGFYLSIVGFIKRFIIGDR ILATIITKIIAIVLAFIAGRVFCGWMCPFGFLFNLVYELRVKLFKLKKLPTVDEKIHNKL IYFKYVVLILVVLAYLSGVKISGYTLAYLLLALFLVLGFIYPMFFCRYVCPVGSLLSIFA RFSIFKLKLDENKCVGCRLCERKCPMQIKITEKIDQMECIRCFECMSVCKKGALSFSAFT KNTKKE
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0749

STRING: 243232.MJ_0749

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii protein MJ0749?

MJ0749 is an uncharacterized protein from the hyperthermophilic methanogenic archaeon Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440). The protein has 246 amino acids in its full-length sequence with a UniProt accession number of Q58159. Current knowledge identifies it as a membrane protein with potential transmembrane domains, though its precise biological function remains to be fully elucidated through structural and functional studies .

What are the physical properties of recombinant MJ0749?

The recombinant MJ0749 protein is typically expressed with a tag (determined during the production process) and stored in a Tris-based buffer with 50% glycerol. This formulation is optimized for stability. The amino acid sequence suggests multiple transmembrane domains and potential metal-binding sites, which may indicate involvement in transport or signaling processes across cell membranes. Researchers should note that the protein's structural characteristics suggest it requires specific handling conditions to maintain functionality .

How should recombinant MJ0749 be stored for optimal stability?

For optimal stability, recombinant MJ0749 should be stored at -20°C for regular use, or at -80°C for extended storage periods. It is recommended to avoid repeated freeze-thaw cycles as these can compromise protein integrity and function. Working aliquots can be maintained at 4°C for up to one week. The protein is typically supplied in a storage buffer containing Tris-based components and 50% glycerol, which helps maintain structural integrity during freeze-thaw processes .

What expression systems are most effective for producing recombinant MJ0749?

The expression of archaeal membrane proteins like MJ0749 presents unique challenges due to their structural complexity and the thermophilic nature of their native environment. Based on approaches used for similar archaeal proteins, E. coli-based expression systems with specialized vectors designed for membrane proteins have shown reasonable success. For optimal expression, consider using:

Expression SystemAdvantagesChallengesRecommended Modifications
E. coli BL21(DE3)High yield, economicalPotential misfoldingLower induction temperature (16-20°C), addition of chaperones
E. coli C41/C43Specialized for membrane proteinsLower yieldExtended expression time, supplemented with rare codons
Yeast systems (P. pastoris)Better folding of complex proteinsMore complex protocolsCodon optimization, inducible promoters

Expression protocols similar to those used for other M. jannaschii proteins can be adapted, with particular attention to temperature control and the addition of stabilizing agents during cell lysis .

What purification strategy is recommended for obtaining high-purity MJ0749?

Purification of MJ0749 requires careful consideration of its membrane-associated characteristics. A multi-step purification protocol is recommended:

  • Initial extraction using mild detergents (DDM or LDAO) to solubilize the protein from membranes

  • Affinity chromatography utilizing the expression tag (commonly His-tag)

  • Size exclusion chromatography to separate oligomeric states and remove aggregates

  • Optional ion exchange chromatography for highest purity

Throughout the purification process, maintaining buffer conditions that mimic the protein's native environment (including potential metal ions) is crucial for preserving structural integrity and function. Researchers should monitor protein quality at each step using SDS-PAGE and Western blotting .

What techniques are most informative for determining the structure of MJ0749?

Due to the uncharacterized nature of MJ0749, a multi-technique approach is recommended for structural determination:

TechniqueInformation ObtainedSpecial Considerations for MJ0749
X-ray CrystallographyHigh-resolution 3D structureChallenging for membrane proteins; requires detergent screening
Cryo-EMMedium to high-resolution structure; visualization of membrane contextSample preparation critical; may require lipid nanodisc incorporation
NMR SpectroscopyDynamic structural information; ligand interactionsSize limitations; isotopic labeling required
CD SpectroscopySecondary structure compositionQuick assessment of folding; useful before detailed analysis
Hydrogen-Deuterium Exchange MSSolvent accessibility; conformational dynamicsProvides insights into transmembrane regions

The approach used successfully for characterizing MJ0936 (crystallization in the presence of metal ions) might be adaptable for MJ0749, particularly if metal binding is suspected to be important for its function .

How can computational approaches complement experimental structural studies of MJ0749?

Computational methods provide valuable insights, especially for difficult-to-characterize proteins like MJ0749:

  • Homology modeling based on structurally characterized proteins with sequence similarity

  • Molecular dynamics simulations to predict conformational changes and stability in membrane environments

  • Protein-protein interaction prediction to identify potential binding partners

  • Functional site prediction to guide experimental mutagenesis studies

These computational approaches should be iteratively refined with experimental data as it becomes available. The amino acid sequence of MJ0749 suggests transmembrane regions that can be computationally modeled to predict membrane topology and potential functional sites .

What approaches are most effective for determining the biochemical function of MJ0749?

Determining the function of an uncharacterized protein requires a systematic approach combining multiple methods:

  • Sequence-based function prediction using advanced bioinformatics tools

  • Biochemical activity screening using substrate panels (similar to the approach used for MJ0936)

  • Metal-dependent activity assays (especially with Ni²⁺ and Mn²⁺, which proved important for MJ0936)

  • Protein-protein interaction studies using pull-down assays or protein microarrays

  • Gene knockout/complementation studies in model systems

When designing biochemical screens, researchers should consider the potential membrane association of MJ0749 and include assays for transport, signaling, or enzymatic functions common in membrane proteins. The successful characterization of MJ0936 as a phosphodiesterase through systematic screening offers a useful methodological template .

How can protein microarray technology be applied to study MJ0749 function?

Protein microarrays represent a powerful approach for high-throughput functional analysis of uncharacterized proteins like MJ0749:

  • Create fusion proteins of MJ0749 with O6-alkylguanine-DNA alkyltransferase (AGT)

  • Immobilize the fusion protein on microarray surfaces through covalent attachment

  • Screen for protein-protein interactions with potential partners from M. jannaschii

  • Identify small molecule interactions that might indicate substrates or ligands

  • Detect post-translational modifications that could regulate MJ0749 function

This approach allows for direct immobilization from cell extracts and enables dual labeling and immobilization options. The selectivity of covalent immobilization makes this method particularly useful for screening complex interaction networks that might reveal MJ0749's biological role .

How does MJ0749 compare structurally and functionally to other characterized proteins from M. jannaschii?

While MJ0749 remains uncharacterized, comparative analysis with better-studied proteins from the same organism can provide valuable insights:

ProteinKnown FunctionStructural FeaturesRelevance to MJ0749 Study
MJ0936PhosphodiesteraseFour-layered structure with β-sheets flanked by α-helices; binuclear metal centerMethodology for functional determination; potential structural similarities
MJ0757Metal-binding proteinMetal coordination domainsPotential similar metal requirements if MJ0749 is metal-dependent
MJ0796ABC transporterMembrane-associated domainsComparative analysis if MJ0749 has transport function

The successful characterization of MJ0936 as a phosphodiesterase through combining structural studies with biochemical activity screening provides a particularly useful template for approaching MJ0749 characterization .

What evolutionary insights can be gained from studying MJ0749?

Evolutionary analysis of MJ0749 can provide context for understanding its potential function:

  • Phylogenetic profiling to identify organisms containing MJ0749 homologs

  • Synteny analysis to examine conservation of genomic context across species

  • Evolutionary rate analysis to identify conserved functional domains

  • Comparative analysis with homologs from mesophilic organisms to understand thermal adaptation

These approaches can help place MJ0749 in an evolutionary context and potentially identify functional constraints that have shaped its sequence over time. Identifying conserved residues across homologs can also guide site-directed mutagenesis experiments to probe function .

How can site-directed mutagenesis be used to probe MJ0749 function?

Site-directed mutagenesis represents a powerful approach for investigating the function of uncharacterized proteins:

  • Identify conserved residues through sequence alignment of MJ0749 homologs

  • Target predicted functional domains based on computational analysis

  • Create alanine substitutions or conservative mutations of key residues

  • Express and purify mutant proteins following the same protocols as wild-type

  • Compare biochemical properties and activities of mutants with wild-type protein

This approach can identify residues critical for structure, stability, or catalytic activity. For membrane proteins like MJ0749, special attention should be paid to residues in predicted transmembrane regions and potential ligand-binding sites .

What considerations are important when designing experiments to study MJ0749 in its native-like environment?

As a membrane protein from a hyperthermophilic archaeon, MJ0749 requires special consideration to maintain a native-like environment during experimental studies:

  • Temperature conditions: Experiments should account for the thermophilic nature of M. jannaschii (optimal growth at 85°C)

  • Membrane mimetics: Consider using archaeal lipids, nanodiscs, or specialized detergents

  • Buffer composition: Include potential cofactors, especially metal ions like Ni²⁺ or Mn²⁺

  • Anaerobic conditions: M. jannaschii is an obligate anaerobe, so oxygen-sensitive functions should be studied accordingly

These environmental considerations can significantly impact the folding, stability, and activity of MJ0749. Experiments conducted under non-native conditions should be interpreted with caution, as they may not reflect the protein's true physiological function .

What strategies can address protein stability issues when working with MJ0749?

Maintaining stability of recombinant MJ0749 presents several challenges:

ChallengePotential SolutionImplementation Notes
Protein aggregationAddition of stabilizing agents (glycerol, specific detergents)Start with 10-20% glycerol; screen detergents systematically
Thermal instability at low temperaturesInclusion of osmolytes (trehalose, TMAO)These can maintain native-like structure in non-thermophilic conditions
Oxidative damageAddition of reducing agents; anaerobic handlingInclude DTT or β-mercaptoethanol; consider working in an anaerobic chamber
Proteolytic degradationAddition of protease inhibitors; shortened purification timeUse a broad-spectrum inhibitor cocktail optimized for archaeal proteins

Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week. For long-term storage, flash-freezing aliquots in liquid nitrogen before transferring to -80°C can help preserve protein integrity .

How can researchers interpret conflicting results when characterizing MJ0749?

When encountering conflicting results in MJ0749 characterization:

  • Evaluate experimental conditions: Different buffer compositions, temperatures, or pH can significantly affect results for proteins from extremophiles

  • Consider protein preparation variations: Expression systems, tags, and purification methods can impact protein folding and function

  • Assess protein quality: Verify protein integrity before each experiment using analytical techniques (SEC, DLS, thermal shift assays)

  • Validate with orthogonal methods: Confirm important findings using multiple independent techniques

  • Compare with homologs: Test whether closely related proteins show similar behaviors under the same conditions

Maintaining detailed experimental records and standardizing protocols across experiments is essential for resolving conflicting results. The unique properties of archaeal proteins often require optimization beyond standard protocols used for mesophilic proteins .

What emerging technologies show promise for further characterizing MJ0749?

Several cutting-edge technologies offer new opportunities for understanding MJ0749:

  • AlphaFold2 and related AI-based structural prediction tools can provide highly accurate structural models even for difficult membrane proteins

  • Single-molecule techniques (FRET, force spectroscopy) can reveal dynamic properties and conformational changes

  • Native mass spectrometry can identify binding partners and complexes under near-native conditions

  • CRISPR-based genome editing in archaeal systems can enable in vivo functional studies

  • Microfluidic platforms for high-throughput biochemical assays can screen diverse conditions and substrates

These technologies can complement traditional approaches and potentially overcome limitations in working with challenging proteins from extremophilic organisms .

How might research on MJ0749 contribute to broader scientific understanding?

Research on uncharacterized proteins like MJ0749 contributes to several fundamental areas:

  • Understanding extremophile biology and adaptation to harsh conditions

  • Discovering novel protein functions and enzymatic mechanisms

  • Revealing evolutionary relationships between archaea and other domains of life

  • Developing new biotechnological applications based on thermostable proteins

  • Enhancing our understanding of protein structure-function relationships in membrane proteins

By systematically characterizing MJ0749, researchers not only fill knowledge gaps about this specific protein but also contribute to broader scientific questions about archaeal biology, evolution, and the diversity of protein functions across the tree of life .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.