Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0759 (MJ0759)

Shipped with Ice Packs
In Stock

Description

Taxonomic Classification and Habitat

Methanocaldococcus jannaschii is an autotrophic archaeon originally isolated from sediment samples collected at the base of a 2600 m deep "white smoker" chimney located at 21°N on the East Pacific Rise . This microorganism represents one of the most thoroughly studied hyperthermophilic methanogens, with significant ecological and evolutionary importance. M. jannaschii thrives in extreme environments, capable of growing at pressures up to more than 500 atmospheres and across a temperature range of 48-94°C, with optimal growth occurring near 85°C . As its name suggests, this organism produces methane and functions as a strict anaerobe, obtaining energy through methanogenesis under oxygen-free conditions .

Genomic Characteristics

The complete genome of M. jannaschii consists of three distinct elements: a large circular chromosome of 1,664,976 base pairs with a G+C content of 31.4%, a large circular extrachromosomal element of 58,407 bp with a G+C content of 28.2%, and a small circular extrachromosomal element of 16,550 bp . The genome sequencing project identified 1,738 predicted protein-coding genes, including numerous uncharacterized proteins such as MJ0759 . This comprehensive genomic characterization has provided invaluable insights into the molecular basis of archaeal biology and extremophile adaptation strategies.

Expression Systems and Purification

The recombinant production of M. jannaschii proteins, including MJ0759, presents significant challenges due to the extremophilic nature of the source organism. Expression systems must accommodate the unique codon usage and potential protein folding requirements of archaeal proteins. While the specific expression system used for commercial production of recombinant MJ0759 is not explicitly detailed in the available search results, the patent literature indicates that isolated nucleic acid molecules from M. jannaschii can be incorporated into recombinant vectors and expressed in suitable host cells using established recombinant techniques .

Functional Characterization Approaches

As an uncharacterized protein, MJ0759 presents numerous opportunities for functional elucidation through various experimental approaches. Sequence-based bioinformatic analyses, structural determination through X-ray crystallography or NMR spectroscopy, and biochemical assays could potentially reveal the protein's biological role. The patent literature suggests that proteins from M. jannaschii can be used to develop diagnostic tools, including probes or amplification primers for detection purposes .

Immunological Applications

The commercial availability of recombinant MJ0759 as an ELISA preparation suggests potential immunological applications. The patent literature indicates that M. jannaschii proteins can be used to raise polyclonal and monoclonal antibodies, which are valuable for detecting protein expression and for purification purposes through techniques such as adsorption chromatography . Epitope-bearing portions of proteins like MJ0759 can be particularly useful for antibody production and subsequent immunological assays .

Biotechnological Potential

Proteins from extremophilic organisms like M. jannaschii often possess unique structural and functional properties that make them valuable for biotechnological applications. The ability to withstand extreme conditions, including high temperatures and pressures, could make MJ0759 potentially useful in industrial processes requiring robust protein components. Additionally, the patent literature suggests that fragments of M. jannaschii genes can be used to control gene expression through mechanisms such as triple helix formation or antisense DNA/RNA .

Current Limitations in Knowledge

Despite the availability of recombinant MJ0759 and its complete amino acid sequence, significant knowledge gaps remain regarding its three-dimensional structure, biochemical function, and biological role within M. jannaschii. The designation as an "uncharacterized protein" reflects this limited understanding. Future research efforts directed at functional characterization will be essential for unlocking the potential scientific and biotechnological value of this protein.

Comparative Genomic Approaches

Comparative analysis of MJ0759 with proteins from related archaeal species or with proteins of known function from other organisms could provide valuable insights into its potential role. The patent literature suggests that ORFs from M. jannaschii that did not elicit homology matches with known sequences represent unique research opportunities . As more archaeal genomes are sequenced and annotated, the potential for identifying functional homologs of MJ0759 increases, potentially shedding light on its biological significance.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ0759; Uncharacterized protein MJ0759
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0759
Target Protein Sequence
MVIKKGEIMNEIISLVSLSVIFGAMLSGFATFRLTGMRLMPHFASLMIAFILTLASLFIS NNIIGYLAIAFQVITPLTVCPTICNILKTQFQNTGIYSAHLALMGMMFILALGNVILF
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0759

STRING: 243232.MJ_0759

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is studying its uncharacterized proteins significant?

Methanocaldococcus jannaschii is a hyperthermophilic methanogenic archaeon first isolated from a submarine hydrothermal vent at a depth of 2600m in the East Pacific Rise. This organism thrives in extreme conditions, growing at temperatures between 48-94°C (with an optimum near 85°C) and at pressures up to 200 atmospheres . M. jannaschii holds particular significance in genomic science as it was the first archaeon to have its complete genome sequenced, consisting of a 1.66 megabase pair circular chromosome with a G+C content of 31.4% .

Studying uncharacterized proteins like MJ0759 is critical for multiple reasons. First, approximately one-third of M. jannaschii's genome remains functionally uncharacterized, representing significant knowledge gaps in archaeal biology . Second, as an evolutionary deeply rooted organism that performs one of the oldest respiratory metabolisms on Earth (hydrogenotrophic methanogenesis), its proteins may provide insights into ancient biochemical processes . Third, proteins from extremophiles often possess unique structural and functional adaptations that can inform biotechnological applications. Finally, understanding these proteins contributes to our knowledge of archaeal information processing systems, which share homology with eukaryotic systems .

What do we currently know about the MJ0759 protein and its characteristics?

MJ0759 is currently classified as an uncharacterized protein from M. jannaschii with the following known characteristics:

  • UniProt accession number: Q58169

  • Length: 118 amino acids

  • Amino acid sequence: MVIKKGEIMNEIISL VSLSVIFGAMLSGFAT FRLTGMRLMPHFASLM IAFILTLASLFISNNII GYLAIAFQVITPLTVCP TICNILKTQFQNTGIY SAHLALMGMMFILALGN VILF

Sequence analysis reveals several notable features:

  • Multiple hydrophobic regions suggesting a membrane-associated protein

  • A distinctive cysteine-containing motif (CPTICNIL) that may be functionally important

  • Regions that suggest transmembrane helices, indicating MJ0759 is likely a membrane protein

What expression systems and methodologies are most effective for producing recombinant M. jannaschii proteins for structural and functional studies?

Multiple expression systems have been developed for recombinant production of archaeal proteins, each with specific advantages and considerations for hyperthermophilic proteins:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coliRapid growth, high yields, simple cultivationPotential misfolding, lack of archaeal PTMsCodon optimization, lower induction temperatures
Yeast (S. cerevisiae, P. pastoris)Eukaryotic folding machinery, secretion capacitySlower growth, glycosylation differencesExpression as fusion proteins with solubility tags
Cell-free systemsRapid, eliminates toxicity issuesHigher cost, limited scaleCan incorporate components from thermophiles
Archaeal hosts (e.g., T. kodakarensis)Native-like environmentTechnical challenges, fewer genetic toolsMost authentic folding and modifications
M. jannaschii genetic systemNative host, authentic processingNew technology, technically challengingEnables in vivo studies of protein function

The recent development of a genetic system for M. jannaschii represents a significant breakthrough for protein production and functional studies . For membrane proteins like MJ0759, methodological considerations include:

  • Expression strategies:

    • Fusion with solubility-enhancing tags (MBP, SUMO, Thioredoxin)

    • Use of specialized E. coli strains designed for membrane proteins (C41/C43)

    • Induction at lower temperatures (16-20°C) to improve folding

  • Purification approaches:

    • Screening multiple detergents for efficient solubilization

    • Inclusion of stabilizing agents (glycerol, specific ions)

    • Heat treatment steps to eliminate mesophilic host proteins

    • Use of the recently developed FLAG/Strep tag system in M. jannaschii

The genetic system for M. jannaschii allows tagging proteins with affinity sequences, enabling purification of proteins with native characteristics and identifying interaction partners in their natural cellular environment .

What bioinformatic approaches can predict the function of uncharacterized archaeal proteins like MJ0759?

Predicting functions of archaeal hypothetical proteins requires specialized bioinformatic approaches that address the unique evolutionary position of archaea:

  • Sequence-based comparative methods:

    • Position-Specific Iterative BLAST (PSI-BLAST) for detecting remote homologs

    • Hidden Markov Model (HMM) profile searches against specialized archaeal databases

    • Transmembrane topology prediction using tools like TMHMM for membrane proteins

    • Analysis of conserved domains and motifs specific to archaeal proteins

  • Structure-based prediction methods:

    • Ab initio protein structure prediction using AlphaFold or RoseTTAFold

    • Structural comparison with characterized proteins using DALI or VAST

    • Binding pocket analysis for substrate prediction

    • Molecular dynamics simulations at high temperatures to assess thermostability

  • Genomic context analysis:

    • Examination of gene neighborhood for functional associations

    • Identification of conserved gene clusters across archaeal species

    • Analysis of synteny with genes of known function

    • Phylogenetic profiling to identify functional associations

The InParanoid database shows that MJ0759 has orthology relationships with proteins from diverse organisms, including Sesamum indicum proteins related to auxin transport (Pin-Likes proteins) and proteins annotated as transporters from other species . This suggests MJ0759 may function as a membrane transporter, although experimental validation is needed to confirm this prediction.

For membrane proteins like MJ0759, specialized tools for predicting transmembrane regions and topology are particularly important for functional inference. Integration of multiple prediction methods increases confidence in functional assignments.

How can the newly developed genetic system for M. jannaschii be applied to study uncharacterized proteins like MJ0759?

The recently developed genetic system for M. jannaschii represents a breakthrough for studying archaeal proteins in their native context . For uncharacterized proteins like MJ0759, this system offers several methodological approaches:

  • Gene knockout strategies:

    • Targeted gene deletion using suicide plasmids with homologous recombination regions

    • Construction of conditional mutants for essential genes

    • Phenotypic analysis of knockout strains under various growth conditions

  • Protein tagging and localization:

    • Addition of affinity tags (3xFLAG-twin Strep) as demonstrated for Mj-FprA

    • Protein localization studies to confirm membrane association

    • Pull-down experiments to identify interaction partners

  • Promoter engineering:

    • Use of engineered versions of native promoters (P* and PflaB1B2*) for controlled expression

    • Overexpression studies to assess protein function

    • Conditional expression to study essential proteins

The method described in the Frontiers in Microbiology paper demonstrates how a suicide plasmid (pDS261) can be used for homologous recombination to modify genomic loci in M. jannaschii . For MJ0759, a similar approach could:

  • Create a tagged version of the protein for purification and interaction studies

  • Generate knockout mutants to observe phenotypic effects

  • Introduce point mutations to test structure-function hypotheses

  • Place the gene under controlled promoters for expression studies

This genetic system has already successfully validated the role of a coenzyme F420-dependent sulfite reductase and demonstrated the existence of a deazaflavin-dependent oxygen neutralization system , illustrating its utility for functional characterization of uncharacterized proteins.

What experimental approaches are most effective for determining the function of membrane proteins like MJ0759?

Determining the function of putative membrane proteins like MJ0759 requires specialized experimental approaches:

  • Membrane protein-specific structural studies:

    • X-ray crystallography with lipidic cubic phase crystallization

    • Cryo-electron microscopy for larger membrane protein complexes

    • Solid-state NMR for dynamics studies

    • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

  • Functional characterization methods:

    • Reconstitution in liposomes or nanodiscs for transport assays

    • Electrophysiology if channel function is suspected

    • Substrate binding assays (SPR, ITC, fluorescence-based)

    • In vivo transport assays with isotope-labeled substrates

  • Genetic approaches:

    • Knockout studies followed by metabolomic profiling

    • Complementation with homologs from other species

    • Site-directed mutagenesis of predicted functional residues

    • Suppressor mutation analysis

  • Systems biology approaches:

    • Transcriptomic analysis under various growth conditions

    • Proteomics to identify changes in protein expression

    • Metabolomics to detect changes in cellular metabolites

    • Network analysis to position the protein in biological pathways

For membrane proteins from hyperthermophiles, special considerations include:

  • Performing assays at physiologically relevant temperatures (80-85°C)

  • Using thermostable detergents and lipids for reconstitution

  • Accounting for the high pressure environment of the native organism

  • Developing thermostable reporter systems for functional assays

The genetic system developed for M. jannaschii provides a powerful platform for in vivo functional studies, allowing researchers to observe phenotypic changes associated with protein modification or deletion in the native host.

How can metabolic pathway reconstruction contribute to understanding potential functions of MJ0759?

Metabolic pathway reconstruction provides a powerful framework for developing hypotheses about uncharacterized proteins in M. jannaschii:

  • Integration with existing pathway knowledge:

    • The recently updated MJCyc pathway-genome database contains 883 reactions, 540 enzymes, and 142 individual pathways

    • Analysis of metabolic gaps in known pathways

    • Identification of potential transport functions needed in specific pathways

    • Assessment of pathway connections requiring membrane transporters

  • Comparative metabolic analysis:

    • Comparison with related methanogens like Methanococcus maripaludis

    • Identification of unique metabolic features in M. jannaschii

    • Analysis of pathway differences between thermophilic and mesophilic methanogens

    • Investigation of archaeal-specific metabolic adaptations

  • Experimental validation approaches:

    • Generation of MJ0759 knockout strains using the M. jannaschii genetic system

    • Metabolomic profiling to identify accumulated or depleted metabolites

    • 13C flux analysis to trace carbon flow through pathways

    • Testing growth on different substrates to identify metabolic deficiencies

If MJ0759 functions as a membrane transporter as predicted by sequence analysis and orthology relationships , metabolic reconstruction could help identify:

  • Potential transported substrates based on pathway requirements

  • Metabolic bottlenecks that might be addressed by transport functions

  • Co-expression patterns with enzymes in specific pathways

  • Metabolic phenotypes expected from transporter deficiency

The automated metabolic reconstruction of M. jannaschii identified 609 metabolic reactions assembled into 113 metabolic pathways , providing a framework for positioning uncharacterized proteins like MJ0759 within the organism's metabolism.

What can we learn about protein thermostability from studying proteins like MJ0759 from M. jannaschii?

Studying proteins from hyperthermophiles like M. jannaschii provides valuable insights into molecular adaptations for thermostability:

  • Primary sequence adaptations:

    • Higher content of charged amino acids (especially at the protein surface)

    • Reduced occurrence of thermolabile residues (Asn, Gln, Cys, Met)

    • Increased hydrophobicity in the protein core

    • More compact amino acid usage

  • Structural features contributing to thermostability:

    • Additional salt bridges and electrostatic interactions

    • Enhanced hydrophobic core packing

    • Shortened surface loops

    • Increased alpha-helical propensity

    • Reduced cavity volume within the protein structure

  • Experimental approaches to study thermostability:

    • Thermal denaturation studies (differential scanning calorimetry, circular dichroism)

    • Hydrogen-deuterium exchange to assess conformational rigidity

    • Comparative structural analysis between thermophilic and mesophilic homologs

    • Molecular dynamics simulations at elevated temperatures

For membrane proteins like MJ0759, additional thermostability factors include:

  • Adaptations in transmembrane regions to maintain stability in archaeal membranes

  • Modifications in lipid-protein interactions

  • Altered hydrophobic matching with the membrane environment

  • Specialized interfacial regions between membrane and aqueous phases

Research has shown that thermophilic proteins from M. jannaschii have "higher residue volume, higher residue hydrophobicity, more charged amino acids, and fewer uncharged polar residues than the mesophilic proteins" . Comparative analysis between MJ0759 and its mesophilic homologs could reveal specific adaptations that contribute to its stability at high temperatures, providing insights for protein engineering applications.

What experimental challenges are unique to working with proteins from hyperthermophilic archaea, and how can they be addressed?

Working with proteins from hyperthermophilic archaea like M. jannaschii presents several unique experimental challenges:

  • Expression challenges:

    • Codon usage differences between archaea and expression hosts

    • Potential toxicity to mesophilic host cells

    • Improper folding at lower temperatures

    • Different co-translational processing mechanisms

  • Purification and stability challenges:

    • Need for specialized equipment for high-temperature assays

    • Potential aggregation during standard purification procedures

    • Different buffer requirements for maintaining stability

    • Unusual post-translational modifications

  • Functional characterization challenges:

    • Limited knowledge of native substrates/interactors

    • Requirement for high-temperature reaction conditions

    • Potential instability of substrates/products at high temperatures

    • Need for specialized equipment for assays at elevated temperatures

Methodological solutions include:

ChallengeSolution ApproachesTechnical Considerations
Expression issuesCodon optimization, specialized expression strains, lower induction temperaturesUse of C41/C43 E. coli strains for membrane proteins
Purification difficultiesHeat treatment steps, stabilizing additives, specialized detergents for membrane proteinsTesting various detergents (DDM, LMNG, SMA) for membrane protein solubilization
Assay limitationsHigh-temperature reaction chambers, thermostable substrates/reagents, specialized equipmentConducting reactions in sealed pressure vessels for volatile substrates
Structural studiesLipidic cubic phase crystallization, specialized cryo-EM approachesAddition of stabilizing antibody fragments or nanobodies
Functional uncertaintyComparative genomics, metabolomic profiling, genetic manipulation in native hostUse of the M. jannaschii genetic system for in vivo studies

The recent development of genetic tools for M. jannaschii provides new opportunities to study proteins in their native context, allowing researchers to overcome some challenges associated with heterologous expression systems .

How can evolutionary analysis of MJ0759 contribute to understanding its function and importance?

Evolutionary analysis provides valuable insights into protein function, particularly for proteins from phylogenetically ancient organisms like M. jannaschii:

  • Phylogenetic analysis approaches:

    • Construction of phylogenetic trees using homologs across domains of life

    • Identification of orthologous relationships as shown in the InParanoid database

    • Analysis of evolutionary rates to identify functionally important residues

    • Reconstruction of ancestral sequences to understand evolutionary trajectories

  • Comparative genomics methods:

    • Analysis of conservation patterns across archaeal species

    • Assessment of genomic context conservation

    • Identification of co-evolving gene families that may functionally interact

    • Synteny analysis to detect functional relationships

  • Molecular evolution techniques:

    • Calculation of dN/dS ratios to detect selection pressure

    • Identification of sites under positive or purifying selection

    • Detection of potential horizontal gene transfer events

    • Analysis of amino acid composition shifts in thermophilic lineages

The InParanoid database shows that MJ0759 has potential orthology relationships with proteins from diverse organisms, including relationships with proteins annotated as transporters and auxin efflux carriers . This evolutionary connection suggests MJ0759 may function in membrane transport processes.

The evolutionary position of M. jannaschii as a deeply rooted methanogen performing one of Earth's oldest respiratory metabolisms (approximately 3.5 billion years old) makes its proteins particularly valuable for understanding early cellular evolution. Analysis of MJ0759's evolution can provide insights into:

  • Whether it represents an ancient protein family or a more recent adaptation

  • Its potential role in core archaeal physiology

  • How membrane transport functions evolved in early cellular life

  • Specific adaptations that allowed transport functions in extreme environments

Understanding these evolutionary patterns can guide functional hypotheses and experimental design for characterizing the biological role of MJ0759.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.