Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0785.1 (MJ0785.1)

Shipped with Ice Packs
In Stock

Description

Genomic and Functional Context

  • Genomic Location: The mj0785.1 gene resides on the 1.66 Mb circular chromosome of M. jannaschii, which contains 1,682 predicted protein-coding regions .

  • Functional Insights:

    • Despite annotation as "uncharacterized," M. jannaschii proteins are implicated in methanogenesis, stress response, and thermostability .

    • MJ0785.1 shows no direct homology to proteins with known functions in public databases .

    • Potential roles in redox regulation or sulfur metabolism are speculative, given the organism’s reliance on sulfite detoxification systems like F420-dependent sulfite reductase .

Product Comparison

SupplierCatalog IDTagLengthPurityPrice
MyBioSource.com MBS7058638NonePartial>90%$1,350.00
Creative BioMart RFL9165MFHisFull (1-189)>90%Inquiry

Storage: Lyophilized powder in Tris/PBS buffer (pH 8.0) with 6% trehalose; stable at -80°C .
Applications: Primarily used in SDS-PAGE, antibody production, and structural studies .

Research Relevance

  • Genetic Tools: M. jannaschii has been engineered for gene knockouts and affinity-tagged protein expression, enabling future functional studies of MJ0785.1 .

  • Extremophile Adaptations: The protein’s thermostability (derived from its host’s 85°C growth optimum) makes it a candidate for biotechnological applications in high-temperature environments .

Unresolved Questions

  • Function: No experimental data confirm its biochemical role.

  • Interactions: No experimentally validated protein partners .

  • Structural Data: No crystallographic or NMR structures are available.

Future Directions

  • Functional Annotation: CRISPR-based genetic screens or homology modeling could elucidate its role .

  • Comparative Genomics: Analysis across Methanocaldococcus species may reveal conserved motifs.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will accommodate your needs if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
In general, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of that specified tag.
Synonyms
MJ0785.1; Uncharacterized protein MJ0785.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0785.1
Target Protein Sequence
MENNKCGTMRGESVYLAYPFILGSVIFVEFFIFGLVYLTFGLGLKTIIITSGVILICLLP ISIILIRLFIKSIAGKNKGKLIKKYTKLKILNKKYKILKVLLFIVGINFYLFGNLVSLNI NPYTKFVLYSISAFFIIISIVVGDVIVEFYENGVFINPLGFYKWGEVGKEDLNDRLILKI DKLVIECKR
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.