Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0790 (MJ0790)

Shipped with Ice Packs
In Stock

Description

Protein Overview

MJ0790 is a 229-amino acid protein (UniProt ID: Q58200) encoded by the MJ0790 gene in M. jannaschii DSM 2661, a model archaeon isolated from deep-sea hydrothermal vents . The recombinant version is produced in E. coli with an N-terminal His tag for purification .

Recombinant Expression Workflow

StepProtocol
ExpressionInduced in E. coli BL21(DE3)
PurificationImmobilized metal affinity chromatography (IMAC) via His tag
ReconstitutionDissolve in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol
Storage- Short-term: 4°C (1 week)
- Long-term: -20°C/-80°C aliquots

Research Applications

MJ0790 is primarily used in:

  • Archaeal Proteomics: Studying membrane protein folding in extremophiles .

  • Structural Biology: Crystallization trials due to high purity and thermostability .

  • Biotechnological Screening: Exploring novel enzyme candidates in methane metabolism pathways .

Genomic and Pathway Context

MJ0790 resides in a genome with 1,770 protein-coding genes, 60% of which lack functional annotation . Key genomic insights:

  • Operon Structure: No evidence of operon association; transcribed as a monocistronic unit .

  • Pathway Links: Not currently mapped to KEGG pathways or BRITE hierarchies .

Challenges and Future Directions

  • Functional Elucidation: Requires knockouts/complementation studies in M. jannaschii, which are hindered by its genetic intractability .

  • Biophysical Studies: High-resolution structures (e.g., cryo-EM) could reveal novel archaeal membrane architectures .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ0790; Uncharacterized protein MJ0790
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0790
Target Protein Sequence
MNWKGHTILGIIFGLPFISSPEQIFLALAGALYPDLDHDVKEDIVKRGLLISGGIVFINI LLYFFDKHLFNVDLFILGVLILLIYLIPYFSDHRGLTHTFWSLLFVSSILGYLAYKLSFI SSVFAGLISLLMVTNEVLLGRVMIFAVFAWAVLDILNPNINVNGALYYILPVVFGYLSHL VGDTMTPAGVRAFYPLSNYKLRKKEGYILVAIWALMAVYVWKYMILSLL
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0790

STRING: 243232.MJ_0790

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant in genomic research?

Methanocaldococcus jannaschii is a thermophilic methanogen belonging to the domain Archaea. It holds significant importance in genomic research as it was the first archaeal organism to have its complete genome sequenced, which provided strong evidence supporting the three-domain model of life . M. jannaschii possesses a large circular chromosome (1.66 mega base pairs) with a G+C content of 31.4%, along with large and small circular extra-chromosomes . The organism grows by producing methane as a metabolic byproduct and can only utilize carbon dioxide and hydrogen as primary energy sources, unlike other methanococci that can also use formate . Its genome sequencing, led by Craig Venter at TIGR using whole-genome shotgun sequencing, revealed unique features that distinguished Archaea as a separate domain from Bacteria and Eukarya .

What experimental approaches are most effective for initial characterization of MJ0790?

When initiating characterization of an uncharacterized protein like MJ0790 from M. jannaschii, researchers should implement a multi-faceted experimental design that combines bioinformatic, biochemical, and structural analyses. The experimental units must be carefully considered and randomly assigned to different treatment conditions to ensure statistical validity .

A recommended experimental approach would include:

  • Sequence analysis and homology modeling to predict structural features

  • Recombinant expression in E. coli or other suitable hosts

  • Purification under conditions that maintain thermostability

  • Basic biochemical characterization (size, oligomeric state, thermal stability)

  • Activity screening against a panel of potential substrates

  • Structural determination through X-ray crystallography or NMR

For such experiments, a completely randomized design (CRD) may be appropriate when working with homogeneous protein preparations, while randomized block design (RBD) would be more suitable when comparing multiple batches or expression conditions .

What expression systems are recommended for archaeal proteins like MJ0790?

For the expression of thermostable archaeal proteins like MJ0790, researchers should consider several factors including codon optimization, post-translational modifications, and protein folding environments. The experimental design should incorporate different expression systems as treatments, with each system representing a distinct experimental unit .

Recommended expression systems include:

Expression SystemAdvantagesLimitationsBest For
E. coli BL21(DE3)High yield, simple, cost-effectiveLimited post-translational modificationsInitial characterization
E. coli RosettaAddresses rare codon usageMay still have folding issuesProteins with rare codons
Thermophilic hosts (T. thermophilus)Native-like folding environmentLower yields, more complexProteins requiring thermophilic conditions
Cell-free systemsAvoids toxicity issuesExpensive, limited scaleToxic proteins, high-throughput screening

When designing expression experiments, researchers should employ replication (at least 3-5 replicates per condition) to ensure statistical validity and should randomize the assignment of experimental units to treatments .

What experimental designs are optimal for functional characterization of uncharacterized archaeal proteins?

The functional characterization of uncharacterized archaeal proteins requires rigorous experimental design that accounts for multiple factors. For MJ0790, researchers should consider implementing a Latin Square Design when investigating three or more factors simultaneously, such as temperature, pH, and substrate concentration . This approach allows for the control of two sources of variation (row and column effects) while studying treatment effects.

A comprehensive functional characterization experimental design should include:

  • Initial broad screening using completely randomized design (CRD) to identify potential functions

  • Refined analysis using randomized block design (RBD) to control for batch-to-batch variability

  • Factorial designs to study interaction effects between environmental conditions (temperature, pH, salt concentration)

  • Latin square designs when testing multiple substrates under varying conditions with limited material

Each experimental unit should be clearly defined, and treatments should be randomly assigned to minimize systematic bias. The design should incorporate appropriate controls and sufficient replication to ensure statistical power for detecting significant effects .

How can structural biology approaches be applied to understand MJ0790's function?

Structural biology provides powerful tools for elucidating the function of uncharacterized proteins like MJ0790. When designing structural biology experiments, researchers should consider the following methodological approaches:

For each method, researchers should implement factorial experimental designs to optimize conditions, considering M. jannaschii's thermophilic nature . Structural data should be analyzed in the context of the organism's unique biochemistry, including its methanogenic pathways and the presence of numerous inteins that may affect protein structure and function .

What bioinformatic approaches can predict potential functions of MJ0790?

When applying bioinformatic approaches to predict the function of MJ0790, researchers should implement a systematic experimental design that treats different computational methods as treatments and evaluates their predictive power .

Recommended bioinformatic approaches include:

  • Sequence-based methods:

    • PSI-BLAST for distant homology detection

    • Hidden Markov Models for identifying conserved domains

    • Analysis of genomic context and operonic structure

  • Structure-based methods:

    • Homology modeling based on solved structures in the PDB

    • Threading algorithms to identify structural similarities

    • Binding site prediction and virtual ligand screening

  • Integration of multiple data types:

    • Protein-protein interaction networks

    • Gene expression correlation analysis

    • Phylogenetic profiling to identify functional partners

Each prediction should be treated as a hypothesis to be experimentally validated. The experimental design for validation should include positive and negative controls, and results should be analyzed using appropriate statistical methods to determine significance .

How should researchers design experiments to study thermal stability of MJ0790?

When studying the thermal stability of MJ0790, researchers should design experiments that account for M. jannaschii's thermophilic nature. A randomized block design (RBD) is particularly suitable for thermal stability studies as it can control for batch-to-batch variation while testing different temperature conditions .

A comprehensive experimental design should include:

  • Differential scanning calorimetry (DSC) experiments with temperature increments as treatments

  • Circular dichroism (CD) spectroscopy at various temperatures to monitor secondary structure changes

  • Activity assays conducted across a temperature gradient

  • Stability studies in the presence of various buffers and additives

For each method, researchers should implement proper local control by forming homogeneous blocks of experimental units and randomly allocating treatments within each block . This approach reduces error variance and increases the precision of the estimates of treatment effects.

What controls are essential when studying uncharacterized proteins like MJ0790?

Essential controls include:

  • Positive controls:

    • Well-characterized proteins from the same organism with known functions

    • Homologous proteins from other organisms with established functions

    • Proteins with similar predicted structural features

  • Negative controls:

    • Denatured protein samples

    • Buffer-only samples

    • Non-related proteins of similar size/structure

  • Technical controls:

    • Expression vector without insert

    • Purification of host proteins processed identically to the recombinant protein

    • Activity assays with heat-inactivated enzyme

Each control should be treated as an experimental unit and randomly assigned within the experimental design to ensure unbiased comparison . The number of replicates for controls should be sufficient to establish statistical significance in subsequent analyses.

How can researchers address data contradictions in archaeal protein characterization studies?

When researchers encounter contradictory data in the characterization of archaeal proteins like MJ0790, a systematic approach to experimental design is essential for resolution. Contradictions may arise from differences in experimental conditions, protein preparation methods, or inherent variability in biological systems.

To address such contradictions, researchers should:

  • Implement factorial designs to systematically test multiple variables that might contribute to the contradictions

  • Use blocking designs (RBD or Latin Square) to control for known sources of variation

  • Increase the number of replicates to improve statistical power

  • Consider using different complementary methodologies to verify results

How might understanding MJ0790 contribute to broader knowledge of archaeal biology?

The characterization of uncharacterized proteins like MJ0790 from M. jannaschii contributes significantly to our understanding of archaeal biology. M. jannaschii, as a thermophilic methanogen, represents an important model for studying adaptations to extreme environments and unique metabolic pathways .

Future research directions should consider:

  • Integration of MJ0790 characterization into the context of M. jannaschii's metabolic networks

  • Comparative analysis with homologs from other archaea and across domains of life

  • Investigation of potential roles in methanogenesis or other archaeal-specific processes

  • Exploration of evolutionary relationships and horizontal gene transfer events

Research designs should incorporate both molecular-level studies and systems biology approaches, using factorial designs to examine how MJ0790 functions under various environmental conditions relevant to M. jannaschii's natural habitat .

What methodological innovations might advance the study of proteins like MJ0790?

Advancing the study of uncharacterized archaeal proteins requires continuous methodological innovation. For proteins like MJ0790, researchers should consider experimental designs that incorporate cutting-edge technologies while maintaining statistical rigor .

Promising methodological approaches include:

  • Cryogenic electron microscopy for structural determination without crystallization

  • High-throughput activity screening using microfluidic platforms

  • Hydrogen-deuterium exchange mass spectrometry for studying protein dynamics

  • In situ studies using archaeal model systems with genetic manipulation capabilities

  • Integration of artificial intelligence for function prediction and experimental design optimization

When implementing these advanced methods, researchers should maintain sound experimental design principles, including appropriate replication, randomization, and local control measures . The combination of innovative technologies with rigorous experimental design will accelerate the characterization of challenging proteins like MJ0790.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.