Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0793 (MJ0793)

Shipped with Ice Packs
In Stock

Description

Production and Functional Context

MJ0793 is part of a genome containing >1,700 protein-coding genes, many of which remain functionally uncharacterized . The recombinant protein is commercially available for research applications, including:

  • Structural studies: Potential insights into archaeal protein folding under high-temperature conditions.

  • Functional screening: Hypothetical roles in stress response, metabolic regulation, or transcriptional control.

Comparison with Related Proteins

While MJ0793 lacks direct functional homologs, its genomic proximity to MJ0797 (an ABC transporter permease) suggests possible involvement in membrane transport or cofactor biosynthesis .

ProteinFunctionKey Features
MJ0793Uncharacterized178 aa, His-tagged, E. coli-expressed
MJ0797ABC transporter permease367 aa, Tris-based buffer, glycerol-stabilized

Research Gaps and Future Directions

Despite its availability, MJ0793’s biological role remains elusive. Critical areas for investigation include:

  1. Biochemical assays: Testing for enzymatic activity (e.g., hydrolase, kinase) or binding interactions.

  2. Proteomic profiling: Co-expression analysis with known methanogenic enzymes (e.g., hydrogenases, methyltransferases) .

  3. Structural biology: X-ray crystallography or cryo-EM to elucidate tertiary structure and active sites.

The lack of functional data underscores the need for high-throughput screening approaches, leveraging M. jannaschii’s sequenced genome and extremophile adaptations .

Biotechnological Potential

MJ0793’s recombinant production via E. coli highlights its suitability for industrial applications, such as:

  • Thermostable enzyme discovery: Potential for heat-resistant catalysts in biocatalysis.

  • Biomarker development: Utility in studying archaeal stress responses or methanogenesis.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MJ0793; Uncharacterized protein MJ0793
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0793
Target Protein Sequence
MKIPIILTLMLFSLGFIFGFISINNLSKINDKDLSNYIPNIQFNFPSILTNNLKVIFLML AGSITFGLSTFINLIFNGFNVGVLIGSISLTNEPLKLITALILPHGIFEISAMLISAVAG FKIPYKVTLYLLDKKEKPLTEEDIKDFLKLSLISIILIVIAAFIEVYITPKIATYLLT
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0793

STRING: 243232.MJ_0793

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of MJ0793 in Methanocaldococcus jannaschii?

MJ0793 is an uncharacterized protein encoded in the genome of Methanocaldococcus jannaschii, a phylogenetically deeply rooted hyperthermophilic methanarchaeon. While specific information about MJ0793 is limited, the genomic organization in M. jannaschii often provides clues about protein function. Global transcriptional analyses like those performed for other M. jannaschii genes can reveal whether MJ0793 is part of a monocistronic mRNA or a polycistronic operon, which may suggest functional relationships with neighboring genes . Research approaches should include examining upstream and downstream genes and investigating potential co-regulation patterns to understand its genomic context.

How can I predict potential functions of MJ0793 using bioinformatic approaches?

Begin with comprehensive sequence analysis using multiple alignment tools to identify conserved domains and motifs. Compare MJ0793 against characterized proteins like FprA from M. jannaschii (Mj_0748 and Mj_0732), examining amino acid sequence identities and similarities . Utilize structural prediction tools like those employed in the Codebook project for uncharacterized transcription factors to identify potential DNA-binding domains . Document your prediction methodology in a structured format:

Table 1: Bioinformatic Analysis Pipeline for MJ0793 Functional Prediction

Analysis StepToolsParametersExpected Outputs
Primary sequence analysisBLAST, HHpredE-value ≤ 10^-5, 3 iterationsHomologous proteins, conserved domains
Structural homology modelingAlphaFold, Phyre2Default parametersPredicted 3D structure, confidence scores
Functional domain predictionInterProScan, PFAMAll available databasesDomain architecture, GO terms
Phylogenetic analysisMEGA, RAxMLMaximum likelihood, 1000 bootstrapsEvolutionary relationships with characterized proteins

What expression systems are most effective for recombinant MJ0793?

For thermostable archaeal proteins like MJ0793, multiple expression systems should be evaluated. Based on successful approaches with other M. jannaschii proteins, consider these options:

  • T7-promoter driven bacterial expression with N-terminal GST-tagged constructs (pTH6838 vector or equivalent)

  • SP6-promoter driven wheat germ extract-based in vitro translation system with N-terminal eGFP-tagged constructs (pTH16500 vector or equivalent)

  • Tetracycline-inducible mammalian expression in FLiP-in HEK293 cells with N-terminal eGFP-tagged constructs (pTH13195 vector or equivalent)

  • PURExpress T7 recombinant in vitro translation system

The choice depends on your downstream applications and protein characteristics. For hyperthermophilic archaeal proteins, E. coli expression often requires codon optimization and may benefit from co-expression with chaperones to enhance solubility.

What purification strategy would yield the highest purity and activity for recombinant MJ0793?

Design a multi-step purification strategy exploiting both the thermostability of M. jannaschii proteins and affinity tags. Start with heat treatment (70-80°C) to denature most host proteins while maintaining MJ0793 structure. Follow with affinity chromatography using the appropriate resin for your tag (GST, His, FLAG, or Strep tags). For highest purity, include ion exchange and size exclusion chromatography steps.

When working with potentially uncharacterized DNA-binding proteins, be cautious of nucleic acid contamination. Include DNase/RNase treatment and high salt washes during purification. Document purification using a table format:

Table 2: Purification Protocol Optimization for Recombinant MJ0793

Purification StepConditionsRecovery (%)Purity (%)Activity (%)Notes
Crude extract-1005-10100Reference point
Heat treatment75°C, 15 min60-7030-4090-95Exploits thermostability
Affinity chromatography[Tag]-specific resin40-5070-8080-85Remove major contaminants
Ion exchangeResource Q, pH 8.030-4085-9075-80Separate charged variants
Size exclusionSuperdex 20025-30>9570-75Final polishing step

How can I determine if MJ0793 functions as a DNA-binding protein or transcription factor?

To characterize potential DNA-binding activity, employ a systematic approach using multiple complementary methods similar to those used in the Codebook project :

  • DNA-binding assays:

    • Protein binding microarrays (PBMs) with different probe sequences

    • SELEX or HT-SELEX (Systematic Evolution of Ligands by Exponential enrichment)

    • ChIP-seq if working in vivo

    • SMiLE-seq (Single-molecule interaction-ligand profiling by sequencing)

  • Motif discovery:

    • Apply multiple motif discovery tools (MEME suite, ExplaiNN, ProBound, etc.)

    • Evaluate motifs using criteria such as predictive capacity and AUROC/AUPRC scores

  • Validation approaches:

    • Electrophoretic mobility shift assays (EMSA) with predicted binding sequences

    • Fluorescence polarization or surface plasmon resonance to quantify binding affinities

    • Mutagenesis of predicted DNA-binding residues to confirm their role

Document binding preferences using position weight matrices (PWMs) and compare results across different experimental platforms to ensure consistency .

What methods should I use to investigate protein-protein interactions involving MJ0793?

Investigate both binary interactions and complex formation using complementary approaches:

  • Pull-down assays with tagged MJ0793 from M. jannaschii lysates

  • Yeast two-hybrid screening against a M. jannaschii genomic library

  • Cross-linking mass spectrometry (XL-MS) to identify interaction interfaces

  • Native mass spectrometry to determine stoichiometry of complexes

  • Co-expression studies with potential interaction partners identified through genomic context

For thermostable proteins like those from M. jannaschii, perform interaction studies at temperatures that maintain native protein conformation. Document interaction partners in a comprehensive table format:

Table 3: Protein Interaction Partners of MJ0793

Partner ProteinDetection MethodInteraction StrengthBinding RegionFunctional ImplicationReference
[Protein X]Pull-down/MSKd = XX μMN-terminal domainPotential regulatory complex-
[Protein Y]Y2H+++C-terminal regionMetabolic pathway connection-

How can I establish a genetic system to study MJ0793 function in vivo?

Developing a genetic manipulation system for M. jannaschii requires sophisticated approaches due to the extremophilic nature of the organism. Based on existing genetic systems for M. jannaschii, construct a suicide plasmid containing:

  • Upstream and 5'-end coding regions of MJ0793 to allow double cross-over homologous recombination

  • An affinity tag coding sequence (e.g., 3xFLAG-twin Strep tag) to facilitate protein detection and purification

  • An engineered promoter to control expression levels

  • A selectable marker like mevinolin resistance for transformant selection

Transform M. jannaschii with linearized plasmid using electroporation under anaerobic conditions. Confirm successful integration through PCR-based analysis of chromosomal DNA . This system allows for both knockout studies and expression of modified versions of MJ0793 to investigate function in its native context.

What approaches can resolve contradictory experimental data when characterizing MJ0793?

When facing inconsistent results, implement a systematic troubleshooting strategy:

  • Technical validation:

    • Verify protein integrity through mass spectrometry

    • Confirm activity of positive controls across all assays

    • Assess batch-to-batch variation in protein preparations

  • Methodological cross-validation:

    • Apply multiple experimental platforms as done in the Codebook project, where "no single experiment type or data analysis approach dominated all others"

    • Employ different motif discovery tools and scoring strategies for binding data

    • Compare results from in vitro and in vivo approaches

  • Contextual factors:

    • Test activity under varying conditions (temperature, pH, salt concentration)

    • Examine potential cofactor requirements

    • Investigate post-translational modifications

Document conflicting results systematically to identify patterns that might explain discrepancies:

Table 4: Reconciliation of Contradictory Experimental Results for MJ0793

Experimental ObservationMethodConditionsPotential ExplanationResolution Strategy
DNA binding observedEMSA65°C, pH 7.5Temperature-dependent activityTest temperature range (50-80°C)
No DNA binding detectedPBM25°C, pH 7.5Suboptimal temperaturePerform PBM at higher temperatures
Enzymatic activity XSpectrophotometric assayAerobicOxygen sensitivityRepeat under anaerobic conditions

How should I design experiments to comprehensively characterize MJ0793 function?

Design a systematic characterization pipeline that integrates multiple approaches:

  • Initial characterization:

    • Express full-length protein and domain constructs (if applicable)

    • Perform basic biochemical characterization (oligomeric state, stability)

    • Screen for potential activities based on bioinformatic predictions

  • Functional analysis:

    • Test binding to various substrates (DNA, RNA, metabolites)

    • Assess enzymatic activities under various conditions

    • Investigate protein-protein interactions

  • Structural studies:

    • Determine 3D structure through X-ray crystallography or cryo-EM

    • Map functional sites through mutagenesis and activity assays

    • Examine conformational changes upon substrate binding

  • Physiological relevance:

    • Generate knockout/knockdown strains if genetic system available

    • Perform complementation studies with wild-type and mutant variants

    • Investigate expression patterns under different growth conditions

Document your experimental design using a structured timeline:

Table 5: Integrated Experimental Design for MJ0793 Characterization

PhaseExperimentsTimelineDependenciesExpected Outcomes
IBioinformatic analysis, Expression optimizationMonths 1-3-Prediction of domains and function
IIPurification, Initial biochemical characterizationMonths 3-6Phase IStable protein preparation, basic properties
IIIFunctional assays, Interaction studiesMonths 6-12Phase IIIdentification of biological activity
IVStructural analysis, MutagenesisMonths 12-18Phase IIIStructure-function relationships
VIn vivo studies, Physiological characterizationMonths 18-24Phase IVBiological role in M. jannaschii

What statistical approaches are most appropriate for analyzing MJ0793 binding data?

When analyzing binding data for potentially uncharacterized DNA-binding proteins like MJ0793, employ rigorous statistical methods similar to those used in the Codebook project :

  • For motif discovery and evaluation:

    • Apply multiple motif discovery tools rather than relying on a single approach

    • Use cross-validation with training and test data sets

    • Evaluate motifs using AUROC (area under receiver operating characteristic) and AUPRC (area under precision-recall curve)

    • Compare motifs across independent experiments for consistency

  • For quantitative binding analysis:

    • Fit binding curves to appropriate models (Hill equation, etc.)

    • Report confidence intervals for all derived parameters

    • Perform statistical tests to compare binding under different conditions

  • For ChIP-seq or similar approaches:

    • Apply appropriate background correction and peak calling

    • Use multiple replicates to ensure reproducibility

    • Consider differential binding analysis when comparing conditions

Document your analysis workflow to ensure reproducibility:

Table 6: Statistical Analysis Pipeline for MJ0793 Binding Data

Analysis StepMethods/ToolsStatistical TestsSuccess CriteriaPotential Pitfalls
Quality controlFastQC, MultiQC-Read depth >20M, quality score >30PCR duplicates, adapter contamination
AlignmentBWA, Bowtie2->80% uniquely mapped readsRepetitive sequences
Peak callingMACS2, GEMp-value <0.01, q-value <0.05>500 reproducible peaksFalse positives in control samples
Motif discoveryMEME, HOMER, ExplaiNN-E-value <0.001Background sequence bias
Motif validationCross-validationAUROC >0.7, AUPRC >0.5Consistent motifs across experimentsOverfitting to training data

How should I present data tables when publishing research on MJ0793?

When preparing data tables for publication, follow these guidelines to ensure clarity and comprehensiveness:

  • Each table must have a clear, descriptive title that relates directly to the data presented

  • Use appropriate column headers that accurately describe the data they contain

  • Include all necessary units of measurement and clearly indicate any data transformations

  • Note statistical significance using established notation (*, **, ***, etc.)

  • Provide detailed footnotes explaining any abbreviations or special considerations

  • Format tables consistently throughout your manuscript

Example table structure for biochemical characterization:

Table 7: Biochemical Properties of Recombinant MJ0793 Under Various Conditions

Parameter25°C37°C65°C85°CMethod
Enzymatic Activity (μmol/min/mg)0.2 ± 0.11.5 ± 0.38.7 ± 0.5*12.3 ± 0.8**Spectrophotometric assay
Binding Affinity (Kd, nM)150 ± 2595 ± 1545 ± 8*30 ± 5**Fluorescence polarization
Thermostability (T1/2, °C)--92 ± 292 ± 2Differential scanning fluorimetry
Oligomeric StateMonomerMonomerDimerDimerSize exclusion chromatography

*p < 0.05, **p < 0.01 compared to activity at 37°C (n=3 biological replicates)

What are the most critical controls needed when publishing novel findings about MJ0793?

When publishing characterization of an uncharacterized protein like MJ0793, rigorous controls are essential for credibility:

  • Expression and purification controls:

    • Empty vector controls processed identically to MJ0793

    • Well-characterized proteins from the same organism (e.g., FprA) expressed and purified in parallel

  • Activity assay controls:

    • Positive controls with known activity

    • Heat-inactivated MJ0793 as negative control

    • Buffer-only controls to establish baseline

    • Dose-response curves to confirm specific activity

  • Binding assay controls:

    • Non-specific DNA/protein for specificity assessment

    • Competition assays with unlabeled substrates

    • Mutant variants with predicted loss of function

  • In vivo controls:

    • Wild-type strains alongside genetic modifications

    • Complementation with wild-type MJ0793 to confirm phenotype specificity

Document all controls systematically in supplementary materials to demonstrate experimental rigor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.