Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0794 (MJ0794)

Shipped with Ice Packs
In Stock

Description

Introduction

Methanocaldococcus jannaschii is a hyperthermophilic methanogen belonging to the domain Archaea . Its genome has been fully sequenced, revealing a number of open reading frames (ORFs) that encode proteins with unknown functions . Among these is the uncharacterized protein MJ0794, also referred to as Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0794 (MJ0794). The study of such proteins is vital to understanding the complete biology of M. jannaschii and to exploring novel protein functions .

Genomic Context and Sequence Analysis

The genome of M. jannaschii contains numerous ORFs, some of which have no homology to known sequences in other organisms . MJ0794 is one such protein, initially identified through the M. jannaschii genome sequencing project . The sequence of MJ0794 can be found within the complete genome sequence of M. jannaschii . Computational tools and nucleotide sequence editing software can be used to analyze and interpret the sequence of MJ0794 .

Recombinant Production and Purification

Recombinant DNA technology allows for the production of MJ0794 in heterologous expression systems such as Escherichia coli . The gene encoding MJ0794 is cloned into a vector, which is then introduced into E. coli cells for protein production . Affinity chromatography or ion exchange chromatography can be employed to purify the recombinant MJ0794 protein .

Functional Studies

Functional studies are essential to determine the biochemical role of MJ0794. These studies may involve:

  1. In vitro assays: Testing the purified protein for enzymatic activity or binding to other molecules.

  2. Genetic studies: Investigating the effect of MJ0794 gene deletion or overexpression on M. jannaschii physiology .

  3. Interaction studies: Identifying proteins that interact with MJ0794, which can provide clues about its function.

Role in Signal Recognition Particle (SRP)

The signal recognition particle (SRP) is a ribonucleoprotein complex responsible for targeting proteins to the prokaryotic plasma membrane . MJ0794 may play a role in the SRP pathway .

Potential Applications

The study of MJ0794 and other uncharacterized proteins from M. jannaschii may have biotechnological applications. For instance, the identification of novel enzymes or protein motifs could lead to the development of new industrial processes or therapeutic agents.

Future Directions

Further research is needed to elucidate the function of MJ0794. This may involve:

  1. Determining its crystal structure.

  2. Identifying its binding partners.

  3. Studying its role in M. jannaschii metabolism and physiology.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request; however, additional fees will apply. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ0794; Uncharacterized protein MJ0794
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0794
Target Protein Sequence
MILMNLIEALTNPDTFFKKLSQKEISLKEPFLIVLIFSILIAISAYISTSIIYKIFPPQY QQVLAFTKIIALISTFIGGIVAWLIIAGFMHLISMIFKGEGSFKKTLSFTGYGFLPNIVG ALITIPIAYYMREISQQEMRL
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0794

STRING: 243232.MJ_0794

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does Methanocaldococcus jannaschii's extreme environment affect protein structure and function studies?

M. jannaschii is a hyperthermophilic, barophilic archaeon originally isolated from a deep-sea hydrothermal vent at 2600m depth . It grows optimally at temperatures around 85°C and pressures over 200 atmospheres under strictly anaerobic conditions . This extreme environment presents unique challenges for protein studies:

  • Thermal stability mechanisms: Proteins must be studied with consideration for their native thermostability adaptations, including increased hydrophobic interactions, ionic bonds, and compact folding.

  • Experimental conditions: Functional assays should ideally be conducted at elevated temperatures (70-85°C) to reflect native conditions.

  • Pressure considerations: Some proteins may have pressure-dependent conformational states that aren't captured in standard laboratory conditions.

  • Oxygen sensitivity: As a strict anaerobe, proteins may require oxygen-free handling to maintain native structure and function.

When working with MJ0794, researchers should consider these environmental factors when designing expression systems, purification protocols, and functional assays .

What genomic context can help predict MJ0794's potential function?

Genomic context analysis provides valuable clues for predicting functions of uncharacterized proteins:

Analysis ApproachApplication to MJ0794Potential Insights
Operon structureExamining neighboring genesMJ0794 is transcribed monocistronically, suggesting independent function
Conserved gene neighborhoodsIdentifying synteny across related speciesPotential functional associations with nearby genes
Phylogenetic profilingTracking co-occurrence with other genesMay reveal functional relationships
Comparative genomicsExamining gene presence/absence patternsPotential role in archaeal-specific processes

A detailed pathway-genome analysis, similar to the recent reannotation efforts for M. jannaschii, can place MJ0794 within the broader metabolic network . The fact that MJ0794 has remained uncharacterized through multiple annotation cycles suggests it may have a specialized or archaeal-specific function rather than belonging to well-characterized protein families.

What are the optimal expression systems for recombinant MJ0794 production?

Expressing archaeal proteins, particularly from hyperthermophiles, presents unique challenges. For MJ0794, consider these expression systems:

  • Bacterial expression (E. coli):

    • Advantages: High yield, simple cultivation, extensive genetic tools

    • Challenges: Potential misfolding of archaeal proteins, lack of archaeal-specific post-translational modifications

    • Recommended strains: BL21(DE3), Rosetta (for rare codons), SHuffle (for disulfide bonds if present)

    • Optimization strategies: Use of low temperature (15-25°C) during induction, co-expression with archaeal chaperones

  • Archaeal homologous expression:

    • Advantages: Native folding environment, proper post-translational modifications

    • Challenges: Lower yields, more complex cultivation requirements

    • Implementation: Use the recently developed genetic system for M. jannaschii with mevinolin/simvastatin selection

  • Cell-free expression systems:

    • Advantages: Rapid production, ability to incorporate modified amino acids

    • Challenges: Limited post-translational modifications

    • Options: PURExpress system or similar archaeal-based cell-free systems

For transmembrane proteins like MJ0794 appears to be, specialized approaches such as using Lemo21(DE3) strains to modulate expression or cell-free systems may be particularly effective .

What purification challenges are unique to proteins from hyperthermophilic archaea like M. jannaschii?

Purifying recombinant proteins from hyperthermophiles presents both challenges and opportunities:

ChallengeMethodological SolutionApplication to MJ0794
Membrane associationDetergent screening (DDM, LDAO, etc.)Critical if MJ0794 is confirmed as a transmembrane protein
Proper foldingHeat treatment (70-80°C) during purificationExploits thermostability to remove E. coli proteins
Oxygen sensitivityAnaerobic purification techniquesMay be necessary depending on cysteine content
Co-purifying contaminantsOrthogonal chromatography methodsCombine affinity, ion exchange, and size exclusion

A significant advantage when working with proteins from hyperthermophiles is the ability to use heat treatment (70-80°C) as an initial purification step to remove most E. coli host proteins . For MJ0794, including an affinity tag (His6, FLAG, or Strep) would facilitate initial capture, followed by tag removal if needed for functional studies .

How can experimental design approaches improve recombinant MJ0794 expression?

Statistical experimental design methodologies can systematically optimize expression conditions:

  • Factorial design approach:

    • Systematically vary key parameters (temperature, inducer concentration, media composition)

    • Example: A 2^4 factorial design testing 4 parameters at 2 levels each

    • Evaluate using protein yield and activity as response variables

  • Key variables to optimize:

    • Induction temperature (15-30°C range often optimal for archaeal proteins)

    • Inducer concentration (0.01-1.0 mM IPTG)

    • Media composition (especially nitrogen and carbon sources)

    • Post-induction time (2-24 hours)

    • Cell density at induction (OD600 0.4-1.0)

  • Validation strategy:

    • Perform triplicate experiments of optimal conditions

    • Verify protein identity by mass spectrometry

    • Assess functional activity if assays are available

This approach has proven successful for challenging proteins, yielding improvements from minimal expression to 250 mg/L of functional protein . For MJ0794, incorporating two-stage dynamic control of metabolism during the production phase could further improve yields of this potentially challenging membrane protein .

What computational approaches can predict structural features of uncharacterized proteins like MJ0794?

Modern computational methods offer powerful approaches to predict structural features:

  • Sequence-based predictions:

    • Secondary structure prediction using JPred, PSIPRED

    • Transmembrane topology prediction using TMHMM, Phobius

    • Analysis of MJ0794 suggests multiple hydrophobic transmembrane regions

    • Disorder prediction using IUPred, PONDR

  • Structure prediction methods:

    • AlphaFold2 or RoseTTAFold can generate high-confidence structural models

    • These models can identify potential binding pockets or catalytic sites

    • For MJ0794, models would likely reveal membrane-associated structural elements

  • Functional inference from structure:

    • Structural similarity searches against PDB using Dali or VAST

    • Identification of conserved domains and motifs

    • Potential binding sites or catalytic residues

  • Integration with experimental data:

    • Guide mutagenesis experiments for functional validation

    • Inform construct design for structural studies

    • Direct screening assays based on predicted function

These computational approaches should be viewed as generating testable hypotheses rather than definitive answers, especially for proteins with low sequence similarity to characterized proteins.

What experimental approaches are most effective for determining the function of uncharacterized archaeal proteins?

A systematic experimental workflow for functional characterization includes:

  • Biochemical screening:

    • Activity assays against substrate panels (for hydrolases, transferases, etc.)

    • Binding assays using thermal shift assays, isothermal titration calorimetry

    • Metal binding analysis using inductively coupled plasma mass spectrometry (ICP-MS)

    • These approaches identified novel phosphodiesterase activity in the previously uncharacterized MJ0936

  • Structural biology approaches:

    • X-ray crystallography (2.4Å resolution achieved for MJ0936 )

    • Cryo-electron microscopy for larger complexes

    • NMR spectroscopy for smaller domains or dynamic regions

  • Genetic approaches:

    • Gene knockout or knockdown studies using the genetic system for M. jannaschii

    • Complementation studies in heterologous systems

    • Transcriptional response analysis under different conditions

  • Protein interaction studies:

    • Pull-down assays with tagged MJ0794

    • Crosslinking mass spectrometry

    • Two-hybrid screens with archaeal systems

For MJ0794, combining structural studies with biochemical screening would be particularly valuable given its uncharacterized status. The approach used for MJ0936, where crystal structure and biochemical assays together revealed phosphodiesterase activity, provides an excellent template .

How can we assess the functional conservation of MJ0794 across archaeal species?

Understanding functional conservation requires multiple analytical approaches:

  • Comparative genomics analysis:

    • Identification of orthologs across archaeal species

    • Analysis of selection pressure using dN/dS ratios

    • Exploration of gene gain/loss patterns across archaeal lineages

  • Sequence conservation mapping:

    • Multiple sequence alignment of MJ0794 orthologs

    • Identification of conserved residues that may be functionally important

    • Mapping conservation onto predicted structural models

  • Experimental validation:

    • Heterologous expression of orthologs from different species

    • Functional complementation studies

    • Comparative biochemical characterization

How can thioredoxin-based proteomic approaches help characterize proteins like MJ0794?

Thioredoxin (Trx)-based proteomic approaches can identify proteins involved in redox networks:

  • Methodology overview:

    • Trx proteins can be used as probes to capture proteins with redox-active cysteine residues

    • M. jannaschii contains two Trx homologs (Mj_0307 and Mj_0581)

    • Proteomic analysis identified 152 potential Trx1 targets in M. jannaschii

  • Application to MJ0794:

    • Determine if MJ0794 is among the proteins captured in Trx-based proteomics

    • If positive, indicates potential role in redox processes

    • Analyze cysteine residues in MJ0794 sequence for potential redox activity

  • Experimental workflow:

    • Express recombinant Trx with active-site mutations

    • Use as bait in pull-down experiments with M. jannaschii lysates

    • Identify interacting proteins by mass spectrometry

This approach could reveal whether MJ0794 participates in redox networks, which would be particularly relevant given the anaerobic lifestyle of M. jannaschii and the potential need to respond to oxidative stress.

What are the challenges in analyzing post-translational modifications of archaeal proteins?

Post-translational modifications (PTMs) in archaeal proteins present unique analytical challenges:

  • Archaeal-specific PTMs:

    • N-linked glycosylation uses different sugars than eukaryotes

    • Unique methylation patterns

    • Archaeal-specific lipid modifications

  • Analytical approaches:

    • Mass spectrometry with enrichment strategies for specific PTMs

    • Site-directed mutagenesis of potential modification sites

    • Comparison of recombinant versus native protein properties

  • Challenges specific to hyperthermophiles:

    • PTMs may be temperature-dependent or pressure-dependent

    • May require analysis under native-like conditions

    • Some modifications may be unstable during standard sample preparation

For MJ0794, determining whether it undergoes archaeal-specific PTMs would require comparison of recombinant protein with native protein isolated from M. jannaschii cultures, which presents significant technical challenges given the growth requirements of this organism .

How can mRNA processing information improve recombinant expression strategies for MJ0794?

Research on mRNA processing in M. jannaschii has revealed unique features that could inform expression strategies:

  • Key findings on archaeal mRNA processing:

    • Endonucleolytic cleavage occurs 12-16 nucleotides upstream of translation start sites in many M. jannaschii mRNAs

    • This processing appears to alter representation of genes in the RNA pool

    • May influence translation efficiency

  • Implications for recombinant expression:

    • Including native 5' UTR elements in expression constructs

    • Designing constructs that mimic processed mRNA structures

    • Optimizing spacing between ribosome binding sites and start codons

  • Experimental approach:

    • Compare expression with constructs containing different 5' leader sequences

    • Analyze mRNA stability and translation efficiency

    • Test effects of various archaeal ribosome binding site configurations

This knowledge could improve expression of challenging archaeal proteins like MJ0794 by incorporating native regulatory elements that optimize translation in heterologous systems.

How does research on uncharacterized proteins like MJ0794 contribute to our understanding of archaeal biology?

Research on uncharacterized proteins from model archaeal organisms provides several important contributions:

  • Completing the functional annotation of archaeal genomes:

    • Despite the M. jannaschii genome being sequenced in 1996, more than a third remains functionally uncharacterized

    • Recent reannotation efforts have updated 104 genes with new functional descriptions

    • Each characterized protein fills crucial gaps in metabolic and cellular networks

  • Understanding archaeal-specific biological processes:

    • May reveal novel pathways not present in bacteria or eukaryotes

    • Contributes to evolutionary models of cellular life

    • Could identify archaeal-specific drug targets

  • Implications for extremophile adaptations:

    • Reveals molecular mechanisms of adaptation to extreme environments

    • Proteins like MJ0794 may have roles in membrane stability under extreme conditions

    • Could identify novel enzymes with biotechnological applications

The fact that MJ0794 has remained uncharacterized through multiple annotation cycles suggests it may represent an archaeal-specific function that doesn't fit easily into known protein families or have close homologs in better-studied organisms.

What strategies can resolve contradictory predictions for uncharacterized proteins?

When faced with contradictory functional predictions, researchers can employ several strategies:

  • Integrative analysis approach:

    • Weight predictions based on the reliability of different methods

    • Identify consensus across multiple prediction platforms

    • Examine predictions in the context of archaeal physiology

  • Targeted experimental validation:

    • Design experiments to directly test competing hypotheses

    • Use site-directed mutagenesis to probe predicted functional residues

    • Employ heterologous complementation studies

  • Structural determination:

    • Solve experimental structure to distinguish between prediction models

    • Use structure to identify potential binding pockets or catalytic sites

    • Compare structural features with functionally characterized proteins

  • Advanced computational methods:

    • Molecular dynamics simulations to evaluate structural stability

    • Docking studies with predicted substrates or binding partners

    • Quantum mechanics/molecular mechanics for potential catalytic mechanisms

This integrated approach has successfully resolved functional annotations for hundreds of previously uncharacterized proteins in the recent M. jannaschii reannotation effort .

How can research on MJ0794 contribute to biotechnological applications?

Research on archaeal proteins, particularly from extremophiles, has significant biotechnological potential:

  • Enzyme discovery and engineering:

    • If MJ0794 has enzymatic activity, its thermostability could be valuable

    • Potential applications in industrial processes requiring extreme conditions

    • Template for protein engineering of thermostable variants

  • Membrane protein applications:

    • If confirmed as a membrane protein, could inform design of stable membrane proteins

    • Potential applications in biosensors or synthetic biology

    • Insight into membrane adaptation to extreme environments

  • Methodological advances:

    • Development of expression and purification protocols for challenging proteins

    • New approaches for membrane protein characterization

    • Advancement of archaeal genetic tools for synthetic biology applications

The characterization of MJ0794 would not only advance fundamental understanding of archaeal biology but could potentially lead to practical applications in biotechnology where thermostable proteins have significant advantages in industrial settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.