Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0795.1 (MJ0795.1)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0795.1 (MJ0795.1) is a protein derived from the archaeon Methanocaldococcus jannaschii . M. jannaschii is a hyperthermophilic methanogen, meaning it thrives in extremely hot environments and produces methane as a metabolic byproduct . MJ0795.1 is considered an uncharacterized protein, which means its specific function within the organism is not yet fully understood .

CharacteristicDescription
Source OrganismMethanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Protein NameUncharacterized protein MJ0795.1
Product TypeRecombinant Protein
Purity>85% (SDS-PAGE)
SourceE. coli
UniProt Accession No.P81233

Structure

Proteins have four levels of structure: primary, secondary, tertiary, and quaternary 3.

Function and Research

As an uncharacterized protein, the precise function of MJ0795.1 in Methanocaldococcus jannaschii is not yet known . Further research is needed to elucidate its role, which could involve various cellular processes. Some studies focus on understanding the roles of RNA and protein cofactors in RNase P catalysis within Methanocaldococcus jannaschii . Additionally, a re-annotation of M. jannaschii's genome has been performed to create an updated resource with novel information and testable predictions in a pathway-genome database . This effort assigned functions to 652 gene products with enzyme roles, accounting for a third of the total protein-coding entries for the genome .

Expression and Purification

Recombinant MJ0795.1 is produced in E. coli, purified, and is available commercially for research purposes . The protein is tagged, although the specific tag type is determined during the manufacturing process .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ0795.1; Uncharacterized protein MJ0795.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0795.1
Target Protein Sequence
MKGINPFYFYIGMALILASIVSILLITKSILLFILLAFGSLVGITLILIYISRKILKIDK GRLKKEVKRIFGNRVYKILRLMLVLGYAGFIYFSGTFYNSAVLFFIFIVAFTISEFYKTY RIRIYEKGILIEGIAFYSWEEIEKTTNKDKNQTILKIKGIPKKIVINEII
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for protein research?

Methanocaldococcus jannaschii is a thermophilic methanogenic archaeon originally isolated from deep-sea hydrothermal vents. It holds significant research value as the first member of the Archaea domain to have its genome sequenced, providing strong evidence for the three-domain classification of life . M. jannaschii possesses a large circular chromosome (1.66 megabase pairs) with a G+C content of 31.4%, along with large and small circular extra-chromosomes . As a hyperthermophile that thrives in extreme conditions, its proteins have evolved unique structural adaptations, making them valuable models for understanding protein stability and function in harsh environments .

What defines MJ0795.1 as an "uncharacterized protein"?

An uncharacterized protein like MJ0795.1 is one whose sequence has been identified in the genome but whose structure, function, interactions, and role in cellular processes remain largely unknown. Similar to uncharacterized proteins studied in other organisms, MJ0795.1 represents one of the numerous predicted proteins from M. jannaschii's genome sequencing whose biological role has not been experimentally confirmed . Uncharacterized proteins comprise a significant portion of sequenced genomes, representing knowledge gaps that need to be addressed through targeted experimental approaches. Stabilizing techniques such as crosslinking prior to cell lysis have proven especially powerful for identifying interactions involving uncharacterized proteins in other organisms .

What growth conditions are required for M. jannaschii cultures when studying native protein expression?

M. jannaschii requires specialized anaerobic growth conditions that simulate its native deep-sea hydrothermal vent environment. For optimal growth in liquid medium, researchers typically use:

ParameterSpecification
Temperature80°C
AtmosphereH₂:CO₂ mixture (80:20, v/v) at 3 × 10⁵ Pa
MediumMarine-based medium lacking oxygen
Agitation200 rpm in shaker incubator
Culture vesselSealed serum bottles with butyl rubber stoppers

For solid medium cultivation, specialized techniques using Gelrite® as a solidifying agent are employed, as traditional agar melts at the high temperatures required . The growth medium is supplemented with Na₂S as a reducing agent, added through a rubber stopper-sealed port to maintain anaerobic conditions . These precise cultivation parameters are essential for expressing native MJ0795.1 protein under conditions that reflect its natural environment.

How can recombinant MJ0795.1 be expressed for structural and functional studies?

Recombinant expression of MJ0795.1 presents unique challenges due to the protein's hyperthermophilic origin. The following methodological approach is recommended:

  • Vector design: Create expression constructs containing the MJ0795.1 gene optimized for the chosen expression system, with appropriate tags for purification and detection.

  • Host selection: While E. coli remains a common initial choice, expression of hyperthermophilic proteins often benefits from hosts like Thermus thermophilus or archaeal hosts with compatible transcription/translation machinery.

  • Expression conditions: For E. coli-based expression, use specialized protocols:

    • Reduce induction temperature to 18-20°C

    • Extend induction time (16-24 hours)

    • Include stabilizing additives like glycerol (5-10%) or osmolytes

    • Co-express chaperones to enhance folding

  • Purification strategy: Implement heat treatment (70-80°C) as an initial purification step to denature host proteins while preserving the thermostable target protein, followed by conventional chromatography techniques.

Similar approaches have been successfully applied to other M. jannaschii proteins, leveraging their intrinsic thermal stability as a purification advantage .

What genetic manipulation techniques are available for studying MJ0795.1 in M. jannaschii?

Genetic manipulation of M. jannaschii has historically been challenging, but recent advancements have established viable approaches. The first genetic system for this hyperthermophilic methanogen was reported in 2019, opening new possibilities for in vivo studies .

Key methodological components include:

  • Selective markers: Mevinolin resistance has been established as a selectable marker, with concentrations of 10 μM for solid media and 20 μM for liquid media .

  • Transformation protocols: DNA can be introduced using polyethylene glycol-mediated transformation adapted for hyperthermophilic conditions.

  • Gene disruption: For studying MJ0795.1 function, targeted disruption can be achieved using homologous recombination with approximately 500 bp DNA elements representing upstream and downstream regions of the target gene .

  • Verification methods: Successful genetic modifications can be verified using DNA hybridization techniques employing digoxigenin (DIG)-labeled probes, with hybridization performed at 42°C and detection using alkaline phosphatase-conjugated anti-DIG antibody, BCIP, and NBT .

These techniques enable direct investigation of MJ0795.1 function through genetic approaches such as gene knockout, promoter modifications, or tagged protein expression in the native host.

How can crosslinking mass spectrometry (XL-MS) be applied to identify MJ0795.1 protein interaction partners?

Crosslinking mass spectrometry (XL-MS) offers a powerful approach for identifying protein interaction partners of uncharacterized proteins like MJ0795.1. Based on similar studies with uncharacterized proteins, the following methodology is recommended:

  • In-cell crosslinking: Apply membrane-permeable crosslinkers like DSSO to intact M. jannaschii cells to stabilize native protein interactions prior to cell lysis .

  • Sample processing workflow:

    • Lyse crosslinked cells under denaturing conditions

    • Fractionate proteins by size or charge

    • Perform trypsin digestion

    • Separate resulting peptides by liquid chromatography

    • Analyze using tandem mass spectrometry

  • Data analysis: Identify crosslinked peptides using specialized software that distinguishes:

    • Intra-protein crosslinks (within MJ0795.1)

    • Inter-protein crosslinks (between MJ0795.1 and partners)

  • Validation strategy: Confirm identified interactions using complementary methods such as co-fractionation mass spectrometry (CoFrac-MS) . Research has shown that approximately two-thirds of protein-protein interactions exhibit higher co-elution scores following in-cell crosslinking, highlighting the importance of stabilizing interactions before cell lysis .

This approach is particularly valuable for uncharacterized proteins, as it can identify interactions that may not survive traditional co-immunoprecipitation approaches due to their transient nature or sensitivity to extraction conditions.

How can AI-assisted structural proteomics accelerate the functional characterization of MJ0795.1?

AI-assisted structural proteomics represents a cutting-edge approach to characterizing uncharacterized proteins like MJ0795.1. Based on recent advancements, the following integrated workflow is recommended:

  • AlphaFold2/RoseTTAFold structure prediction: Generate high-confidence structural models of MJ0795.1 to identify potential functional domains and binding sites.

  • Experimental validation pipeline:

    • Deploy crosslinking MS to capture in vivo protein interactions

    • Perform co-fractionation MS to validate stable complexes

    • Map crosslink sites onto predicted structures to confirm interaction interfaces

  • Structure-function analysis: Compare predicted MJ0795.1 structures with characterized proteins to identify potential functional analogs, even in the absence of sequence similarity.

  • Guided mutagenesis strategy: Based on structural predictions and interaction data, design targeted mutations to validate:

    • Critical residues for thermal stability

    • Potential active sites or binding interfaces

    • Protein-protein interaction surfaces

This integrated approach has successfully identified functions for previously uncharacterized proteins, as demonstrated in recent research where experimental data from global proteomic approaches, structure modeling, and in vivo validation converged to identify novel protein-protein interactions and demonstrate their biological functions .

What strategies can resolve contradictions in experimental data when studying MJ0795.1?

When investigating uncharacterized proteins like MJ0795.1, researchers often encounter contradictory experimental results that must be systematically addressed:

  • Multi-method validation approach:

    • Deploy at least three orthogonal techniques to investigate the same property

    • When contradictions arise, implement a decision tree based on method reliability under specific conditions

    • Consider the influence of experimental conditions (temperature, salt concentration, pH) on result consistency

  • Environmental context analysis: Systematically evaluate how the extreme native conditions of M. jannaschii affect experimental outcomes:

Condition FactorPotential Impact on MJ0795.1 StudiesMitigation Strategy
High temperature (80°C)Altered protein dynamics in mesophilic systemsConduct comparative assays at multiple temperatures
High pressureModified interaction kinetics at atmospheric pressureUse pressure-mimicking solutes when possible
Anaerobic environmentOxidation artifacts in aerobic systemsInclude reducing agents; work in anaerobic chambers
  • Native vs. recombinant protein comparative analysis: Establish a framework to systematically compare data obtained from recombinant versus native protein sources, accounting for post-translational modifications, folding differences, and interaction partners present in the native context.

  • Data integration protocol: Develop a weighted evidence approach that prioritizes results based on their relevance to in vivo conditions, technical reproducibility, and statistical robustness.

By implementing these strategies, researchers can systematically address contradictions and develop a coherent understanding of MJ0795.1 function despite experimental limitations.

How can computational approaches predict potential functions of MJ0795.1?

Predicting the function of uncharacterized proteins like MJ0795.1 requires sophisticated computational approaches that integrate multiple data types:

  • Comparative genomics strategies:

    • Analyze genomic context of MJ0795.1 to identify conserved gene neighborhoods

    • Examine phylogenetic profiles to identify co-evolution patterns with proteins of known function

    • Search for distant homologs using profile-based methods (PSI-BLAST, HMMs)

  • Structural bioinformatics pipeline:

    • Generate 3D structural models using AlphaFold2 or similar tools

    • Perform structural similarity searches against characterized proteins

    • Identify potential binding pockets or catalytic sites

    • Calculate electrostatic surface properties relevant to thermostability

  • Network inference approach:

    • Integrate protein-protein interaction data from crosslinking experiments

    • Map MJ0795.1 into functional network modules

    • Apply guilt-by-association principles to predict function

  • Machine learning implementation:

    • Train models on features from characterized extremophile proteins

    • Generate function predictions with confidence scores

    • Validate predictions through targeted experiments

These approaches have successfully identified functions for previously uncharacterized proteins in other organisms and provide a systematic pathway to developing testable hypotheses about MJ0795.1 function .

How might studying MJ0795.1 contribute to understanding inteins in M. jannaschii?

M. jannaschii contains an unusually large number of inteins (19 identified in one study), which are protein splicing elements that self-excise from host proteins . Investigating potential relationships between MJ0795.1 and inteins could provide valuable insights:

  • Intein prediction and verification approach:

    • Analyze MJ0795.1 sequence for conserved intein motifs

    • If present, design experiments to verify splicing activity:

      • Express recombinant constructs with and without putative intein regions

      • Compare migration patterns via SDS-PAGE

      • Perform mass spectrometry to confirm splicing

  • Functional implications assessment:

    • Investigate whether intein splicing regulates MJ0795.1 activity

    • Examine environmental factors that influence splicing efficiency

    • Assess evolutionary conservation of intein insertion sites

  • Intein-based applications exploration:

    • Evaluate potential of MJ0795.1-associated inteins for biotechnological applications

    • Develop protein purification strategies leveraging intein splicing properties

    • Design protein engineering approaches using intein-mediated protein trans-splicing

This research direction not only addresses fundamental questions about MJ0795.1 but also contributes to the broader understanding of protein splicing mechanisms in extremophiles .

What are the major challenges in expressing and characterizing thermostable proteins like MJ0795.1?

Researchers working with hyperthermophilic proteins face several distinct challenges that require specialized approaches:

  • Expression system limitations:

    • Mesophilic hosts (e.g., E. coli) may produce misfolded proteins

    • Codon optimization requirements for heterologous expression

    • Potential toxicity of thermophilic proteins in mesophilic hosts

  • Experimental condition discrepancies:

Native ConditionLaboratory ChallengeMethodological Solution
80°C optimal temperatureStandard assays designed for 25-37°CDevelop high-temperature compatible assay formats
High pressure environmentAtmospheric pressure in standard labsPressure chambers or pressure-mimicking solutes
Specialized cofactorsLimited availability of archaeal cofactorsIdentify and synthesize required cofactors
  • Structural characterization hurdles:

    • Crystallization challenges at high temperatures

    • NMR signal broadening at elevated temperatures

    • Need for specialized equipment for biophysical analyses at extreme conditions

  • Functional validation complexities:

    • Limited genetic tools for native host manipulation

    • Difficulty establishing physiologically relevant assay conditions

    • Challenges in reconstituting native protein complexes

Addressing these challenges requires innovative approaches combining specialized expression systems, high-temperature compatible assays, and integrated computational and experimental strategies .

How can emerging technologies enhance our understanding of MJ0795.1?

Several cutting-edge technologies show particular promise for advancing research on uncharacterized proteins from extremophiles:

  • Cryo-EM applications:

    • Single-particle analysis for structural determination without crystallization

    • Visualizing MJ0795.1 in native complexes

    • Capturing conformational states relevant to function

  • Next-generation crosslinking techniques:

    • Photoactivatable crosslinkers for millisecond-timescale interaction capturing

    • Proximity-dependent labeling (BioID, APEX) adapted for thermophilic conditions

    • Integrative structural biology combining crosslinking data with AlphaFold predictions

  • High-throughput functional screening:

    • Microfluidics-based assays adapted for high-temperature conditions

    • Droplet-based directed evolution for function discovery

    • Deep mutational scanning to map sequence-function relationships

  • Single-cell approaches for archaeal systems:

    • Development of archaeal-specific reporters

    • Adaptation of RNA-seq and proteomics to single archaeal cells

    • Microfluidic cultivation of M. jannaschii under controlled conditions

These emerging technologies promise to overcome current limitations in studying extremophile proteins and could provide unprecedented insights into the structure, function, and interactions of MJ0795.1 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.