Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0796.1 (MJ0796.1)

Shipped with Ice Packs
In Stock

Description

MJ0796.1 exhibits ATP hydrolysis activity critical for transporter function:

Catalytic Mechanism

  • ATP Binding: Cooperative kinetics with a Hill coefficient of 1.7, indicating positive cooperativity between two nucleotide-binding sites .

  • Hydrolysis: Wild-type MJ0796.1 hydrolyzes ATP at a V<sub>max</sub> of 0.2 s<sup>−1</sup> and K<sub>m</sub> of 50 μM . Mutation of the catalytic base (E171Q) abolishes hydrolysis but preserves ATP binding .

MutantATPase ActivityDimerizationRole
Wild-typeActive (0.2 s<sup>−1</sup>)ATP-dependentCatalyzes ATP hydrolysis
E171QInactiveATP-stabilized dimerTraps ATP-bound state for structural studies

Production and Purification

Recombinant MJ0796.1 is commercially available with standardized production protocols:

ParameterDetails
Host SystemE. coli (common for high-yield expression)
TagN-terminal His-tag for affinity chromatography
Purity≥85% (SDS-PAGE verified)
Molecular Weight15.9 kDa (full-length, residues 1–137)
StorageLyophilized or liquid at −80°C; stable for 12 months

Conformational Dynamics

  • ATP binding induces dimerization, while hydrolysis (γ-phosphate release) triggers α-helical subdomain rotation, facilitating nucleotide exchange .

  • Structural studies using MgADP-bound MJ0796.1 revealed a β-sheet fusion mechanism, relevant to protein aggregation studies .

Evolutionary Insights

  • MJ0796.1 homologs (e.g., E. coli LolD) share conserved ATPase mechanics, highlighting evolutionary preservation of ABC transporter function .

Pharmacological Relevance

  • While MJ0796.1 itself is not directly linked to human diseases, ABC transporters like ABCB1 (associated with epilepsy drug resistance) share mechanistic parallels .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ0796.1; Uncharacterized protein MJ0796.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0796.1
Target Protein Sequence
MMIDNISNFDKVRAVVVAILLYIFIILVVDGSISSLIGKYITYPSDEYHIIEFYDFIHII GFLLSLSISTYFSSKDIIKDFAKFFTIFFGITFILGITLFLGLTFFENHIPSMRGYTTLM LFFFLLNLFKKLDKITN
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MJ0796.1 and why is it significant for ABC transporter research?

MJ0796.1 is a nucleotide binding domain (NBD) protein from the hyperthermophilic archaeon Methanocaldococcus jannaschii. This protein has become a prototypical model for studying ABC (ATP-binding cassette) transporter mechanisms due to several advantageous characteristics. The protein forms distinct ATP-bound dimers and exhibits complete dimer dissociation following ATP hydrolysis, making it ideal for investigating the coupling between ATP binding, hydrolysis, and conformational changes . As an archaeal protein, MJ0796 provides evolutionary insights into the conserved mechanisms across diverse ABC transporters. Additionally, M. jannaschii's hyperthermophilic nature confers exceptional stability to the protein, facilitating biochemical and structural studies under various experimental conditions .

The significance of MJ0796.1 stems from the abundance of structural and functional information available, positioning it as an excellent experimental model for investigating fundamental questions about ABC transporter mechanisms . The protein's well-characterized behavior provides researchers with a reliable system to explore broader questions about ATP hydrolysis, energy transduction, and conformational coupling in membrane transport proteins.

What structural characteristics define MJ0796.1?

MJ0796.1 exhibits the canonical NBD fold characteristic of ABC transporters with several defining structural elements that facilitate its function:

  • Walker A and Walker B motifs: These conserved sequences form the ATP binding pocket. The Walker A motif contains a crucial lysine (K44) that interacts with ATP's phosphate groups .

  • Q-loop region: This structural element undergoes significant conformational changes during the ATP hydrolysis cycle. The Q-loop contains several key segments (QL1-QL5) with the peptide bond between QL4 and QL5 (L104-W105) serving as a conformational hinge . The conserved glutamine residue in this loop plays a critical role in catalysis by coordinating the magnesium ion required for ATP hydrolysis .

  • A-loop: Contains a conserved aromatic residue (Y11) that stacks with the adenine ring of ATP and contributes to nucleotide binding specificity .

  • α3-α4 loop region: This segment exhibits high torsion angle transitions and may be involved in subunit contacts during dimerization and potentially in interactions with transmembrane domains (TMDs) in full transporters .

  • ENI motif: Acts as a fulcrum about which the loop at the C-terminus of α3 pivots, facilitating conformational changes during the catalytic cycle .

The protein contains naturally occurring cysteine residues (C53 and C128) that have been substituted in many experimental studies to create cysteine-less variants for specific labeling strategies .

How does ATP binding affect MJ0796.1 dimerization?

ATP binding drives the dimerization of MJ0796.1 monomers, a process essential for the catalytic cycle of ABC transporters. Research has established that binding of ATP to both nucleotide-binding sites (NBSs) is necessary to form a stable dimer capable of catalyzing ATP hydrolysis . This represents a cooperative mechanism where both binding sites must be occupied to achieve the proper dimerization interface.

In size-exclusion chromatography experiments conducted in the absence of ATP, MJ0796.1 and its various mutants consistently elute as a single peak at the position corresponding to a monomer . Upon ATP addition, wild-type MJ0796 forms dimers that can be detected using various biophysical techniques including tryptophan fluorescence quenching and luminescence resonance energy transfer (LRET) .

The requirement for two bound ATP molecules has been demonstrated through studies of various Walker A motif mutations. When key residues involved in ATP binding are mutated (K44A, K44E, S42F, Y11A), the proteins fail to form stable dimers even in the presence of ATP . This indicates that both binding sites must be engaged with ATP to establish the necessary conformational changes and intermolecular contacts that stabilize the dimer structure.

What is the mechanism of ATP hydrolysis in MJ0796.1 dimers?

The ATP hydrolysis mechanism in MJ0796.1 dimers reveals a remarkable asymmetry that challenges earlier models of ABC transporter function. Research has definitively established that hydrolysis at just one of the two nucleotide-binding sites drives complete dissociation of the NBD dimer . This finding was confirmed through ingenious experiments using heterodimers composed of one catalytically active monomer (MJ, the wild-type protein) and one catalytically defective monomer (MJI, containing the E171Q mutation that abolishes hydrolysis) .

The key experimental evidence comes from rapid mixing experiments in a stop-flow chamber, which showed that NBD heterodimers with one functional and one inactive catalytic site dissociated at a rate indistinguishable from that of homodimers with two hydrolysis-competent sites . By comparing the rates of dimer dissociation and ATP hydrolysis, researchers confirmed that dissociation followed the hydrolysis of a single ATP molecule .

The catalytic mechanism involves several critical elements:

  • Catalytic carboxylate: Glutamate 171 (E171) serves as the catalytic base that activates a water molecule for nucleophilic attack on the γ-phosphate of ATP . Mutation of this residue to glutamine (E171Q) abolishes hydrolysis activity while preserving ATP binding capability.

  • Walker A lysine: Lysine 44 (K44) coordinates the phosphate groups of ATP and is essential for both binding and hydrolysis. Mutations of this residue (K44A or K44E) prevent ATP binding and subsequent dimerization .

  • Magnesium coordination: A magnesium ion coordinated by the conserved glutamine in the Q-loop positions the ATP molecule properly for hydrolysis .

Protein VariantATP BindingDimerizationHydrolysisDimer Dissociation Rate
MJ (Wild-type)YesYesYesNormal
MJI (E171Q)YesYesNoRequires partner hydrolysis
MJ-K44ANoNoNoN/A
MJ-K44ENoNoNoN/A
MJ-S42FReducedReducedReducedN/A
MJ-Y11AReducedReducedReducedN/A

This asymmetric hydrolysis model has profound implications for understanding the power stroke mechanism in ABC transporters and how ATP energy is harnessed to drive substrate transport .

How do mutations in the Walker A motif affect MJ0796.1 function?

Mutations in the Walker A motif of MJ0796.1 have revealed critical roles for specific residues in ATP binding, dimerization, and hydrolysis. The Walker A motif (also known as the P-loop) contains the consensus sequence GxxGxGKS/T, where K is a highly conserved lysine essential for ATP binding .

Systematic studies of Walker A mutations in MJ0796.1 have provided the following insights:

  • K44A and K44E mutations: Replacement of the conserved lysine (K44) with either alanine or glutamic acid completely abolishes ATP binding capacity . These mutants are unable to form dimers even at high ATP concentrations, demonstrating that the positively charged lysine is irreplaceable for coordination of ATP's negatively charged phosphate groups . The K44E mutation introduces repulsive electrostatic interactions that further inhibit ATP binding.

  • S42F mutation: Substitution of serine 42 with phenylalanine introduces a bulky side chain that sterically hinders ATP binding . This mutation significantly reduces but does not completely eliminate ATP binding, resulting in decreased dimerization efficiency and reduced hydrolysis rates.

  • Y11A mutation: Although not technically part of the Walker A motif, the A-loop's conserved aromatic residue (Y11) works in concert with Walker A to bind ATP . The Y11A mutation disrupts the π-stacking interaction with the adenine ring of ATP, reducing binding affinity and subsequent dimerization.

These mutations have different effects on the hydrogen-bonding network that coordinates ATP within the binding pocket. Molecular dynamics simulations of related NBD proteins have shown that disruption of these precise interactions affects not only ATP binding but also the transmission of conformational changes from the binding site to distant regions of the protein .

Understanding these structure-function relationships is vital for designing experiments to investigate the coupling between ATP binding/hydrolysis and the conformational changes driving substrate transport in complete ABC transporters.

What role does the Q-loop play in MJ0796.1 activity?

The Q-loop in MJ0796.1 functions as a critical conformational switch that couples ATP binding and hydrolysis to structural changes necessary for transporter function. This loop contains a conserved glutamine residue that coordinates the catalytic magnesium ion essential for ATP hydrolysis .

Molecular dynamics simulations have revealed that the Q-loop exhibits remarkable conformational flexibility. The peptide bond between positions QL4 and QL5 (L104-W105 in HisP, equivalent positions in MJ0796) undergoes high dihedral angle transitions, suggesting it serves as a conformational hinge . Additionally, the ψ angle of F99 shows significant transitions, providing another potential hinge point .

Comparison of crystal structures from different ABC transporters has shown that the Q-loop can adopt two distinct conformations:

  • Extended conformation: Observed in HisP, MJ0796, MalK (monomer A), and TAP1 structures, where the conserved glutamine's Cα atom is positioned close to the catalytic site .

  • Coiled conformation: Found in MJ1267 structures, associated with partial unzipping of β-strands 8 and 9 at their C-termini, resulting in withdrawal of the glutamine from the catalytic site .

The transition between these conformations primarily involves a significant change in the backbone dihedral angle between positions equivalent to QL4 and QL5 in MJ0796 . This conformational switch mechanism allows the Q-loop to transmit information about the nucleotide state (ATP-bound, hydrolysis transition state, or ADP+Pi-bound) to other regions of the protein, particularly the α3-α4 loop that may interact with transmembrane domains in full transporters .

Functional studies have demonstrated that the precise positioning of the Q-loop glutamine is essential for coordinating the magnesium ion that facilitates ATP hydrolysis. Mutations affecting Q-loop flexibility or the conserved glutamine itself disrupt this coordination and significantly impair catalytic activity .

What expression systems are optimal for producing recombinant MJ0796.1?

Recombinant expression of MJ0796.1 has been successfully achieved using Escherichia coli as the primary host system, despite the archaeal origin of the protein. The established methodology involves several key steps and considerations:

  • Expression vector selection: Most studies have utilized standard E. coli expression vectors with inducible promoters (typically T7-based systems) to control protein expression . The specific vector choice should account for the desired fusion tags and cloning strategies.

  • Host strain optimization: E. coli strains optimized for protein expression (BL21(DE3) and derivatives) have proven effective for MJ0796.1 production . These strains lack certain proteases and contain the T7 RNA polymerase gene under lac promoter control for inducible expression.

  • Purification strategy: Standard purification protocols involve a two-step chromatography approach:

    • Anion-exchange chromatography as the initial capture step

    • Gel-filtration chromatography for polishing and buffer exchange

  • Mutation considerations: When expressing MJ0796.1 variants, researchers have successfully incorporated various mutations including:

    • Cysteine substitutions (C53G, C128I) to create cysteine-less backgrounds

    • Introduction of specific cysteines (G14C) for site-directed labeling

    • Catalytic mutations (E171Q) to abolish ATP hydrolysis

    • Introduction of tryptophan (G174W) as a fluorescence probe

For researchers working with the native organism, recent developments have established a genetic system for Methanocaldococcus jannaschii that enables direct genetic manipulation . This system allows for:

  • Gene knockout or modification directly in M. jannaschii

  • Addition of affinity tag sequences for protein isolation with native attributes

How can LRET be utilized to study MJ0796.1 dimerization?

Luminescence Resonance Energy Transfer (LRET) has proven to be a powerful technique for investigating MJ0796.1 dimerization dynamics, providing temporal resolution of conformational changes during the ATP binding and hydrolysis cycle . The implementation of LRET for studying MJ0796.1 involves several methodological considerations:

  • Site-specific labeling: Single-cysteine variants of MJ0796.1 (typically MJ0796-G174W-G14C) are labeled with donor and acceptor fluorophores. The G14C mutation introduces a unique cysteine residue for specific labeling, while natural cysteines (C53 and C128) are replaced with glycine and isoleucine, respectively .

  • Donor-acceptor pair selection: Optimal LRET measurements require:

    • A donor with relatively long fluorescence lifetime

    • An acceptor with spectral overlap with the donor emission

    • Minimal direct excitation of the acceptor at donor excitation wavelengths

    • Donor-acceptor distance within the Förster radius range (typically 30-80Å)

  • Experimental setup: LRET experiments for studying MJ0796.1 dimerization typically use:

    • Rapid mixing in a stop-flow chamber to initiate dimerization or dissociation

    • Time-resolved detection systems to capture the fluorescence lifetimes and energy transfer efficiency

    • Temperature control to maintain consistent conditions

  • Control experiments: Critical controls include:

    • Single-labeled proteins to determine direct excitation and bleed-through

    • ATP-binding deficient mutants (K44A) as negative controls for dimerization

    • Hydrolysis-deficient mutants (E171Q) to isolate binding from hydrolysis events

A particularly powerful application of LRET involves the creation of heterodimers consisting of one donor-labeled active NBD (MJ) and one acceptor-labeled catalytically defective NBD (MJI) . This approach allowed researchers to demonstrate that ATP hydrolysis at just one of the two nucleotide-binding sites is sufficient to drive complete dimer dissociation, resolving a fundamental question about ABC transporter mechanism .

Protein PairDonor/AcceptorATP AdditionExpected LRET SignalInterpretation
MJ+MJYes/YesYesHigh → LowDimerization followed by dissociation after hydrolysis
MJI+MJIYes/YesYesHigh (stable)Stable dimers due to lack of hydrolysis
MJ+MJIYes/YesYesHigh → LowDissociation rate similar to MJ+MJ, indicating single-site hydrolysis drives dissociation
MJ-K44A+MJYes/YesYesLow (unchanged)No dimerization due to ATP binding defect

By comparing the kinetics of LRET signal changes with ATP hydrolysis rates measured independently, researchers can dissect the temporal relationship between nucleotide binding, hydrolysis, and conformational changes in MJ0796.1 .

What molecular dynamics approaches reveal MJ0796.1 conformational changes?

Molecular dynamics (MD) simulations provide valuable insights into the conformational dynamics of MJ0796.1 that are often inaccessible through static structural techniques. Though not directly applied to MJ0796.1 in the provided references, MD approaches used on homologous NBD proteins like HisP reveal principles applicable to understanding MJ0796.1 function .

The established MD protocol for studying ABC transporter NBDs includes:

  • System preparation:

    • Starting with a high-resolution crystal structure (such as HisP with bound ATP, PDB: 1B0U)

    • Adding catalytic magnesium through superimposition with structures containing Mg2+ (e.g., Rad50 with MgAMP-PNP, PDB: 1FTU)

    • Solvating the system with explicit water molecules (TIP3P model) in a 6Å shell

    • Using appropriate force fields (CHARMM22 all-atom force field)

  • Simulation parameters:

    • Time-step: 1.5 fs

    • Temperature: 300K maintained via coupling to a water bath

    • Non-bonded cutoff: 14Å with shift and switching functions engaging at 12Å

    • SHAKE algorithm to constrain bond lengths involving hydrogen atoms

  • Equilibration protocol:

    • Initial minimization with fixed protein heavy atoms

    • Heating from 75K to 300K during a 5-ps MD run

    • Production run for 390 ps at constant temperature (300K)

    • Coordinate saving every 0.3 ps for analysis

  • Analysis techniques:

    • Backbone dihedral angle tracking to identify conformational hinges

    • Root mean square deviation (RMSD) calculations to assess structural stability

    • Hydrogen bond network analysis

    • Principal component analysis to identify dominant motions

Key insights from MD simulations applicable to MJ0796.1 include:

  • Conformational hinges: High torsion angle transitions in the Q-loop region (specifically between positions L104-W105 and the ψ angle of F99 in HisP, equivalent positions in MJ0796) indicate conformational hinges that facilitate structural changes during the catalytic cycle .

  • α3-α4 loop dynamics: The loop connecting helices α3 and α4 exhibits significant flexibility, with residues 123-125 showing high torsion angle transitions. This suggests this region's involvement in subunit contacts and potentially in interactions with transmembrane domains .

  • ENI motif function: The ENI motif appears to act as a fulcrum about which the loop at the C-terminus of α3 pivots, potentially transmitting conformational changes between domains .

These MD approaches provide a dynamic view of NBD function that complements experimental structural and biochemical data, offering testable hypotheses about the conformational changes driving ABC transporter function.

How should contradictory ATP hydrolysis data be interpreted?

When analyzing apparently contradictory ATP hydrolysis data for MJ0796.1, researchers should implement a systematic approach that considers multiple factors affecting experimental outcomes. Contradictions in hydrolysis data often arise from differences in experimental conditions, protein preparations, or analytical methods.

A comprehensive framework for interpreting such data includes:

  • Experimental condition assessment:

    • Temperature effects: MJ0796.1 originates from a hyperthermophile (optimal growth at 85°C), so activity at different temperatures can vary significantly .

    • Buffer composition: Ionic strength, pH, and specific ions (particularly Mg2+) critically influence ATP binding and hydrolysis rates .

    • Protein concentration: Higher concentrations promote dimerization, potentially masking defects in dimerization-impaired mutants .

    • ATP concentration: Sub-saturating ATP concentrations may produce different kinetic behaviors than saturating conditions .

  • Protein preparation variables:

    • Expression system differences: The presence of post-translational modifications or folding chaperones can affect protein activity .

    • Purification method variations: Different chromatography techniques may select for distinct protein conformations or oligomeric states .

    • Storage conditions: Freeze-thaw cycles or oxidation can affect cysteine-containing variants differently .

  • Methodological considerations:

    • Direct vs. coupled assays: Direct measurement of ATP hydrolysis (e.g., thin-layer chromatography) versus coupled enzyme assays may yield different apparent rates .

    • Steady-state vs. pre-steady-state kinetics: Single-turnover experiments may reveal mechanistic details masked in steady-state measurements .

    • Heterodimer vs. homodimer systems: Experiments with mixed wild-type/mutant systems provide unique insights into asymmetric functions .

When confronted with contradictory data, the following analytical approach is recommended:

  • Compare experimental conditions systematically, creating a table of variables across different studies.

  • Perform control experiments that bridge different methodologies on the same protein preparation.

  • Consider the time scales of measurements relative to the steps in the catalytic cycle (ATP binding, NBD dimerization, hydrolysis, Pi release, ADP release, dimer dissociation) .

  • Develop kinetic models that can accommodate apparently contradictory data by incorporating multiple conformational states or parallel reaction pathways.

What analytical techniques best characterize MJ0796.1 structural transitions?

Characterizing the structural transitions of MJ0796.1 during its catalytic cycle requires a multi-technique approach that captures different aspects of protein dynamics across various timescales. Based on successful applications in the literature, the following analytical techniques provide complementary insights:

  • Spectroscopic techniques:

    • Tryptophan fluorescence quenching: Exploits the intrinsic fluorescence of tryptophan residues (typically G174W mutation) to monitor changes in local environment during dimerization and dissociation .

    • Luminescence Resonance Energy Transfer (LRET): Provides distance measurements between labeled sites during dimerization/dissociation events with excellent temporal resolution .

    • Circular Dichroism (CD): Monitors secondary structure changes during nucleotide binding and hydrolysis.

  • Structural methods:

    • X-ray crystallography: Provides atomic-resolution snapshots of different states, particularly using ATP analogs or hydrolysis-deficient mutants (E171Q) to capture pre-hydrolysis states .

    • Small-angle X-ray scattering (SAXS): Characterizes global conformational changes and oligomeric states in solution under various conditions.

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies regions with altered solvent accessibility during the catalytic cycle.

  • Hydrodynamic techniques:

    • Size-exclusion chromatography: Distinguishes between monomeric and dimeric states .

    • Analytical ultracentrifugation: Provides precise measurements of molecular weight and oligomeric states under equilibrium conditions.

  • Computational approaches:

    • Molecular dynamics simulations: Reveal conformational flexibility and transition pathways inaccessible to experimental techniques .

    • Normal mode analysis: Identifies intrinsic dynamic modes that may be functionally relevant.

The optimal strategy combines multiple techniques targeting different aspects of the same transition. For example, characterizing ATP-induced dimerization can involve:

TechniqueInformation ProvidedTemporal ResolutionSpatial Resolution
LRETReal-time monitoring of dimer formation/dissociationMilliseconds1-10 Å between labels
Tryptophan fluorescenceLocal conformational changesMillisecondsSite-specific
Size-exclusion chromatographyPopulation distribution between monomer/dimerMinutesDistinguishes oligomeric states
X-ray crystallographyAtomic details of interfacesStatic snapshotsAtomic (1-3 Å)
Molecular dynamicsConformational transitionsFemtoseconds to nanosecondsAtomic movements

Particularly valuable insights have come from combining rapid kinetic measurements of dimer dissociation (using LRET) with steady-state ATP hydrolysis assays, allowing researchers to establish the causal relationship between hydrolysis at a single site and dimer dissociation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.