Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0871 (MJ0871)

What is the current state of knowledge about MJ0871?

MJ0871 is an uncharacterized protein from the hyperthermophilic methanogenic archaeon Methanocaldococcus jannaschii. The protein consists of 317 amino acids and is identified in the UniProt database with the accession number Q58281. Based on available information, MJ0871 has not been functionally characterized, though its full amino acid sequence has been determined: MIVVDYITPLMESMKISAYYTIRISIIVLTTVFIVNYIMSTGIMKKLSNMLSPILRRLKVNPLSISSTLACFFSPTVGYSILAEGLKENKVNEREVIGASLANSFPSVLSHTFTFFIPVVVPILGHTGVLYVLIRLGVALAKTIIGFLYLSIISEDYSFEMPEINKLNKKENAKKSFKSTIRFAKRLIPIMFFMMTLVLYLSKIGFFDYVEKFVQPITNLLNLNPNVGILALTEIMNVQAAIVMAGGFLNEGILSSKEVLIGLIIGNVLTFSTRYVKHSLPLHVSLFGAKLGTKIVMVNAAITLLLDIFIIAGLLLI . This sequence information provides a starting point for structural predictions and functional hypotheses, though experimental validation remains necessary.

What expression systems are most effective for producing recombinant MJ0871?

E. coli has been successfully employed as an expression system for recombinant MJ0871, with the protein fused to an N-terminal His tag to facilitate purification . When designing expression protocols, researchers should consider that M. jannaschii is a hyperthermophilic organism with growth optimum around 85°C, which may affect protein folding in mesophilic expression hosts. The typical approach involves:

• Cloning the MJ0871 gene into an expression vector with an N-terminal His tag

• Transforming the construct into an E. coli expression strain (BL21(DE3) or similar)

• Inducing expression under controlled conditions

• Harvesting cells and purifying the protein via affinity chromatography

What are the recommended storage and handling protocols for purified MJ0871?

Purified recombinant MJ0871 is typically supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . For optimal storage and handling:

• Store the lyophilized protein at -20°C to -80°C upon receipt

• For reconstitution, briefly centrifuge the vial prior to opening

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (typically 50%) for long-term storage

• Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

• Store working aliquots at 4°C for up to one week

The protein is typically stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during freeze-thaw cycles .

What initial characterization methods should be applied to MJ0871?

For systematic characterization of an uncharacterized protein like MJ0871, researchers should employ multiple complementary approaches:

When designing experiments, researchers should consider that characterization of M. jannaschii proteins often requires assay conditions that reflect the organism's thermophilic nature, including elevated temperatures and potential requirements for specific metal ions.

How can computational approaches guide functional prediction for MJ0871?

Computational analysis should precede wet-lab experimentation to generate functional hypotheses for MJ0871. A systematic approach includes:

• Sequence similarity searches using BLAST, HHpred, and HMMER against protein databases

• Structural prediction using AlphaFold2, I-TASSER, or similar tools

• Domain and motif analysis using PROSITE, InterPro, and SMART

• Genomic context analysis examining neighboring genes in the M. jannaschii genome

• Phylogenetic profiling to identify coevolution patterns

What experimental strategies can determine if MJ0871 has enzymatic activity?

To systematically investigate potential enzymatic activities of MJ0871, researchers should:

• Begin with broad-spectrum activity screens testing for common enzymatic functions such as:

  • ATPase/GTPase activity (phosphate release assays)

  • Phosphatase activity (p-nitrophenyl phosphate assay)

  • Protease activity (fluorogenic peptide substrates)

  • DNA/RNA binding (electrophoretic mobility shift assays)

• Design targeted assays based on computational predictions

• Examine enzyme characteristics including:

  • Metal ion dependencies (similar to M. jannaschii DNA ligase requiring Mg²⁺ or Mn²⁺)

  • Optimal pH and temperature conditions

  • Substrate specificity profiles

• Validate activity through site-directed mutagenesis of predicted catalytic residues

The case of Mj0968 provides an instructive example where initial characterization suggested it was a P-type ATPase, but more comprehensive analysis revealed its primary function as a phosphatase with only minimal ATPase activity . This highlights the importance of testing multiple possible activities and carefully designing control experiments.

How should researchers approach structural studies of MJ0871?

Structural characterization of MJ0871 requires specialized approaches due to its predicted membrane-associated nature:

• Sample preparation considerations:

  • For crystallography: Detergent screening to identify optimal solubilization conditions

  • For NMR: Isotopic labeling (¹⁵N, ¹³C) during recombinant expression

  • For cryo-EM: Lipid nanodisc or amphipol reconstitution to maintain native structure

• Crystallization strategies:

  • Vapor diffusion methods with commercial screening kits designed for membrane proteins

  • Lipidic cubic phase crystallization

  • Use of crystallization chaperones or antibody fragments to increase ordered crystal contacts

• Data collection and processing:

  • For challenging crystals, consider synchrotron radiation sources

  • For cryo-EM, optimize freezing conditions and data collection parameters

  • Implement appropriate phase determination methods (molecular replacement may be challenging due to lack of homologous structures)

• Model validation and refinement:

  • Rigorous statistical validation using MolProbity or similar tools

  • Independent experimental validation of structural features

The resulting structural data should be integrated with functional assays to develop comprehensive models of MJ0871's biological role.

How can researchers address contradictory experimental results with MJ0871?

When faced with conflicting experimental data on MJ0871 function, researchers should implement a systematic troubleshooting approach:

• Verify protein quality:

  • Confirm protein purity via multiple methods (SDS-PAGE, mass spectrometry)

  • Assess protein folding using circular dichroism or thermal shift assays

  • Evaluate potential for batch-to-batch variation

• Examine experimental conditions:

  • Test activity across wide ranges of temperature, pH, and ionic strength

  • Consider the hyperthermophilic nature of M. jannaschii (optimal growth at 85°C)

  • Evaluate buffer components for potential inhibitory effects

• Apply alternative methodologies:

  • Use multiple independent assay formats to measure the same activity

  • Implement both in vitro and in vivo approaches when possible

  • Consider substrate specificity issues

• Design critical control experiments:

  • Include both positive and negative controls

  • Perform site-directed mutagenesis of predicted functional residues

  • Use heterologous complementation in model organisms

What statistical approaches are recommended for analyzing MJ0871 activity data?

For rigorous analysis of biochemical data from MJ0871 characterization experiments:

Data should be presented in properly formatted tables following scientific conventions. For example, when measuring enzymatic parameters:

All experiments should include appropriate replicates (minimum n=3), and error bars should represent standard deviation or standard error of the mean as appropriate3.

How does characterization of MJ0871 contribute to understanding extremophile biology?

M. jannaschii is a hyperthermophilic methanogen isolated from deep-sea hydrothermal vents, growing optimally at 85°C and pressures exceeding 200 atm. Characterizing MJ0871 contributes to understanding extremophile adaptations in several ways:

• Protein stability mechanisms: Analysis of MJ0871's structural features may reveal strategies for maintaining functional proteins under extreme conditions, such as:

  • Increased hydrophobic core packing

  • Additional salt bridges and hydrogen bonding networks

  • Strategic placement of disulfide bonds

  • Reduced flexibility in loop regions

• Membrane adaptation strategies: If MJ0871 is confirmed as a membrane protein, its characterization would provide insights into:

  • Membrane fluidity maintenance at high temperatures

  • Pressure adaptation mechanisms

  • Archaeal-specific membrane protein organization

• Metabolic adaptation: Functional characterization may connect MJ0871 to unique metabolic pathways enabling survival in extreme environments

This research contributes to the broader field of astrobiology and origin-of-life studies, as extremophiles like M. jannaschii provide models for potential extraterrestrial life or early Earth organisms.

What techniques would enable in vivo functional studies of MJ0871?

In vivo studies of MJ0871 function present significant challenges due to the extreme growth conditions of M. jannaschii and limited genetic tools. Researchers might consider:

• Heterologous expression approaches:

  • Expression in other archaeal hosts with more developed genetic systems (Thermococcus, Sulfolobus)

  • Expression in thermophilic bacterial models

  • Creation of chimeric proteins with homologs from genetically tractable organisms

• Gene editing strategies:

  • CRISPR-Cas9 adaptation for hyperthermophilic archaea

  • Homologous recombination-based approaches

  • Antisense RNA technologies

• Functional complementation:

  • Identification of MJ0871 homologs in model organisms

  • Complementation studies in knockout strains

  • Phenotypic analysis under various stress conditions

• Live-cell imaging approaches:

  • Development of thermostable fluorescent proteins for fusion studies

  • High-pressure microscopy techniques

  • Microfluidic systems for single-cell analysis under extreme conditions

These approaches would need to be adapted to the challenging growth requirements of M. jannaschii or implemented in surrogate host systems.

What biotechnological applications might emerge from MJ0871 research?

While MJ0871 remains uncharacterized, proteins from extremophiles frequently demonstrate biotechnological potential. Potential applications include:

• Enzyme technology:

  • If MJ0871 exhibits enzymatic activity, its thermostability could be valuable for industrial processes

  • Potential applications in PCR technology, biofuel production, or food processing

• Protein engineering:

  • Structural motifs contributing to MJ0871's presumed thermostability could inform protein design

  • Development of stabilized versions of mesophilic proteins for biotechnological applications

• Membrane technology:

  • Insights from MJ0871 structure could inform design of stable artificial membranes

  • Applications in biosensors, drug delivery systems, or biocatalytic membrane reactors

• Diagnostic applications:

  • Similar to how M. jannaschii DNA ligase has been applied to SNP genotyping , novel applications may emerge from MJ0871 characterization

The potential for such applications highlights the importance of pursuing basic research on uncharacterized proteins from extremophilic organisms.