Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0880 (MJ0880)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, customers can specify their preferred tag type for prioritized development.
Synonyms
MJ0880; Uncharacterized protein MJ0880
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0880
Target Protein Sequence
MDILPYLTKIILLSSIGITIASIIVETNLISKIKKITKPICLISNLPEECVVSLLGNFIN PTVGKSMLSGFYKENKVNEKEVIVTTIISPLPTILGESVFRVQLPLAVVILGYKLGLIYV SLNVISGFLQALIGILYANIFFERRQINIDNNNNEKIVFNREVIIKGFKKSLKILKKVIP MIVIFTLLINFLIKLGLMDVVKGLFSPIFRILDLPGEAITVLIANLAHFSAGYTTVDILI KNGVLNEKQALIVLLIGNIISVTMIYLKHSIGTYISLFGRFGLKLAVINYTISVMIKILL ILLLIAFF
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0880

STRING: 243232.MJ_0880

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most suitable for producing recombinant MJ0880?

Based on available information, E. coli has been successfully used as an expression host for recombinant MJ0880 protein production . When selecting an expression system, researchers should consider:

  • Codon optimization for the expression host to enhance translation efficiency

  • Induction conditions that minimize inclusion body formation

  • Temperature modulation during expression (potentially lower temperatures to slow protein folding)

  • Co-expression with archaeal chaperones if misfolding occurs

For archaeal proteins like MJ0880, the E. coli BL21(DE3) strain with pET vector systems typically provides good expression levels, although specialized strains like Rosetta or Arctic Express may be beneficial if codon bias or folding issues are encountered. Alternative expression systems such as yeast (P. pastoris) might be considered if E. coli expression results in inactive protein.

How can researchers effectively purify recombinant His-tagged MJ0880?

The recombinant MJ0880 protein has been produced with a histidine tag , which facilitates purification using immobilized metal affinity chromatography (IMAC). An effective purification protocol should include:

  • Cell lysis under conditions that maintain protein solubility (consider detergents if membrane-associated)

  • IMAC purification using Ni-NTA or similar resin

  • Optimization of binding and elution conditions

  • Secondary purification steps such as ion exchange or size exclusion chromatography

  • Buffer optimization for stability during storage

For thermostable archaeal proteins like MJ0880, consider incorporating a heat treatment step (65-75°C for 15-20 minutes) before chromatography, which can denature many host cell proteins while leaving the thermostable target protein intact. Monitor purification efficiency using SDS-PAGE and Western blotting with anti-His antibodies.

What biophysical techniques are recommended for initial characterization of MJ0880?

For an uncharacterized protein like MJ0880, a systematic approach to biophysical characterization should include:

  • Size determination by size exclusion chromatography and/or dynamic light scattering

  • Thermostability assessment using differential scanning fluorimetry or circular dichroism

  • Secondary structure analysis via circular dichroism spectroscopy

  • Oligomerization state analysis through analytical ultracentrifugation

  • Intrinsic fluorescence measurements to assess tertiary structure

Given the thermophilic origin of MJ0880, special attention should be paid to temperature-dependent structural changes. Characterize the protein at both mesophilic (25-37°C) and thermophilic (65-85°C) temperatures to understand its native behavior.

How can researchers predict potential functions of MJ0880 based on sequence analysis?

In the absence of experimental functional data, computational approaches offer valuable insights:

Analysis MethodPurposeToolsOutput
Sequence homologyIdentify related proteins with known functionsBLAST, HHpredPotential functional homologs
Domain predictionIdentify conserved functional domainsPfam, SMART, InterProPutative domain architecture
Secondary structurePredict structural elementsPSIPRED, JPredα-helices, β-sheets patterns
Subcellular localizationPredict cellular locationPSORT, SignalPPotential functional environment
Phylogenetic analysisEvolutionary relationshipsMEGA, PhyMLConservation across species

Consider integrating multiple prediction algorithms and looking for consensus. For archaeal proteins like MJ0880, specialized archaeal databases may provide more relevant comparisons than general protein databases.

What approaches can elucidate protein-protein interactions involving MJ0880?

Understanding the interaction network of an uncharacterized protein like MJ0880 can provide crucial functional insights. Recommended methodological approaches include:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged MJ0880 in a suitable host

    • Perform pulldown experiments under native conditions

    • Identify co-purifying proteins by mass spectrometry

    • Validate interactions through reciprocal pulldowns

  • Yeast two-hybrid screening:

    • Consider specialized Y2H systems adapted for archaeal proteins

    • Use both N- and C-terminal fusions to avoid masking interaction domains

    • Validate positive interactions with alternative methods

  • Proximity labeling approaches:

    • Fuse MJ0880 to BioID or APEX2

    • Express in a heterologous system

    • Identify labeled proximal proteins by streptavidin purification and MS

  • Surface plasmon resonance or isothermal titration calorimetry:

    • For validating and quantifying specific interactions

    • Determine binding kinetics and thermodynamic parameters

When interpreting interaction data, consider that archaeal proteins may have different interaction partners in their native environment compared to heterologous systems.

How should researchers design experiments to assess the biochemical activity of MJ0880?

Without prior knowledge of MJ0880's function, a systematic experimental design should include:

  • Generic enzymatic activity screening:

    • Test for common enzymatic activities (hydrolase, transferase, oxidoreductase)

    • Perform assays at elevated temperatures (65-85°C) reflecting M. jannaschii's optimal growth conditions

    • Screen with various cofactors (metal ions, nucleotides, vitamins)

  • Substrate screening approaches:

    • Metabolite array screening

    • Differential scanning fluorimetry with potential ligands

    • Activity-based protein profiling

  • Genetic approaches:

    • Gene deletion or silencing in M. jannaschii (if genetic tools available)

    • Heterologous expression and complementation in model organisms

    • Transcriptional co-regulation analysis to identify functionally related genes

  • Structural guided approaches:

    • Identify potential active sites or binding pockets

    • Perform targeted mutagenesis of conserved residues

    • Assess activity changes in mutant variants

For each experiment, include appropriate positive and negative controls, and consider the extreme conditions (high temperature, potentially anaerobic) under which M. jannaschii proteins naturally function.

What structural biology techniques are most appropriate for MJ0880 characterization?

The choice of structural techniques depends on research goals and protein properties:

  • X-ray crystallography:

    • Advantages: Highest resolution potential (< 1.5 Å)

    • Challenges: Requires protein crystallization

    • Methodological considerations: Screen various crystallization conditions optimized for thermostable proteins; consider surface entropy reduction mutations to promote crystallization

  • Cryo-electron microscopy (cryo-EM):

    • Advantages: No crystallization required; can capture multiple conformational states

    • Challenges: Typically requires larger proteins (>100 kDa) unless part of a complex

    • Methodological approach: Consider analyzing MJ0880 in complex with interaction partners if the protein itself is too small

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Advantages: Provides dynamic information; solution state analysis

    • Challenges: Size limitations (typically <30 kDa for detailed analysis)

    • Methodological considerations: Isotopic labeling (13C, 15N) required; consider selective labeling strategies

  • Small-angle X-ray scattering (SAXS):

    • Advantages: Provides low-resolution envelope; works in solution

    • Methodological approach: Combine with computational modeling for hybrid structure determination

For all structural studies of archaeal proteins like MJ0880, buffer conditions reflecting the native environment (ionic strength, pH, temperature stability) should be carefully optimized.

How can researchers address the challenges of studying MJ0880 in its native context?

Studying archaeal proteins in their native context presents several challenges:

  • Genetic manipulation strategies:

    • Develop or adapt transformation protocols for M. jannaschii

    • Consider CRISPR-Cas9 systems optimized for archaeal hosts

    • Use selectable markers appropriate for thermophilic archaea

    • Implement inducible promoter systems for controlled expression

  • Physiological relevance assurance:

    • Monitor protein expression under different growth conditions

    • Perform in situ localization using immunofluorescence or epitope tagging

    • Correlate phenotypic changes with biochemical activities

  • Environmental condition replication:

    • Design experiments that account for high temperature (85°C)

    • Maintain anaerobic conditions when necessary

    • Consider high pressure effects if relevant (M. jannaschii is a deep-sea organism)

  • Specialized equipment considerations:

    • Adapt standard laboratory equipment for high-temperature reactions

    • Use pressure vessels for mimicking deep-sea conditions

    • Develop specialized anaerobic chambers for thermophilic growth

When interpreting results, consider the unique cellular context of archaea, which differs significantly from bacterial and eukaryotic model systems more commonly used in molecular biology.

What computational approaches can integrate MJ0880 into metabolic and regulatory networks?

For uncharacterized proteins like MJ0880, computational network integration can provide functional context:

  • Genome context analysis:

    • Examine genomic neighborhood for functionally related genes

    • Identify conserved operons across related species

    • Look for gene fusion events that might indicate functional relationships

  • Co-expression network analysis:

    • Analyze transcriptomic data to identify genes with similar expression patterns

    • Construct condition-specific co-expression networks

    • Identify network modules containing MJ0880

  • Protein-protein interaction prediction:

    • Use tools like STRING, STITCH, or archaeal-specific interaction databases

    • Integrate experimental interaction data if available

    • Apply interolog mapping from better-characterized related species

  • Metabolic network integration:

    • Map MJ0880 to metabolic pathways based on predictive functional assignments

    • Identify metabolic pathway gaps that MJ0880 might fill

    • Perform flux balance analysis with different functional assignments

  • Evolutionary profile analysis:

    • Construct phylogenetic profiles across multiple species

    • Identify proteins with similar evolutionary patterns

    • Infer functional relationships from co-evolution patterns

These computational approaches should generate testable hypotheses about MJ0880's role in cellular processes, guiding experimental design.

How should researchers interpret contradictory results when characterizing MJ0880?

When confronting contradictory results, a systematic approach includes:

  • Technical validation:

    • Verify protein identity through mass spectrometry

    • Confirm protein integrity via size exclusion chromatography

    • Assess protein folding using circular dichroism or fluorescence spectroscopy

    • Rule out contaminating activities from host proteins

  • Contextual considerations:

    • Compare results from different expression systems

    • Evaluate the impact of tags or fusion partners on activity

    • Consider buffer composition effects (pH, salt, cofactors)

    • Assess temperature-dependent effects on structure and function

  • Statistical robustness:

    • Implement appropriate statistical tests for activity data

    • Perform power analysis to ensure adequate sample size

    • Use multiple technical and biological replicates

    • Consider Bayesian approaches for integrating disparate data types

  • Alternative hypotheses formulation:

    • Consider multifunctional protein possibilities

    • Evaluate allosteric regulation as a source of variability

    • Assess oligomerization state changes under different conditions

    • Investigate post-translational modifications

Contradictions often arise when studying proteins from extremophiles in non-native conditions, so careful consideration of the archaeal origin of MJ0880 is essential when interpreting discrepancies.

What controls are essential when studying MJ0880 in heterologous systems?

  • Protein-specific controls:

    • Empty vector/untransformed host cells

    • Catalytically inactive mutants (if active site residues identified)

    • Related proteins with known functions as positive controls

    • Heat-denatured MJ0880 for thermostability studies

  • Expression system controls:

    • Monitor potential interference from host proteins

    • Assess the impact of different tags (N-terminal vs. C-terminal)

    • Compare results across multiple expression systems

    • Evaluate codon optimization effects

  • Assay-specific controls:

    • Include substrate-only and enzyme-only controls

    • Implement internal standards for quantification

    • Use time-course measurements to establish reaction kinetics

    • Perform dose-response experiments

  • Environmental condition controls:

    • Test activity across temperature ranges

    • Evaluate pH-dependent effects

    • Assess salt and cofactor requirements

    • Compare aerobic versus anaerobic conditions

Systematic application of these controls helps distinguish true MJ0880 properties from artifacts of the experimental system.

How can researchers optimize conditions for activity assays with MJ0880?

For uncharacterized proteins like MJ0880, condition optimization is crucial:

ParameterOptimization ApproachConsiderations for MJ0880
TemperatureTest range from 25-95°CFocus on hyperthermophilic range (75-90°C)
pHScreen pH 4-10Consider intracellular pH of M. jannaschii
Buffer compositionTest multiple buffer systemsHEPES, phosphate, MES for thermal stability
Salt concentrationVary from 0-500 mMConsider high salt adaptation of marine archaea
Divalent cationsScreen Mg2+, Mn2+, Ca2+, Zn2+Test individually and in combinations
Reducing agentsInclude DTT or β-mercaptoethanolEssential for proteins with cysteine residues
Stabilizing additivesGlycerol, trehalose, PEGMay improve stability during assays
SubstratesConcentration gradientsEstablish Km if activity detected

A design of experiments (DOE) approach can efficiently explore this multidimensional parameter space. Consider specialized high-throughput methods to simultaneously test multiple conditions, and remember that optimal conditions for archaeal proteins often differ significantly from those of bacterial or eukaryotic proteins.

What mass spectrometry approaches are most informative for MJ0880 characterization?

Mass spectrometry offers multiple avenues for protein characterization:

  • Protein identification and verification:

    • Peptide mass fingerprinting for initial confirmation

    • Tandem MS (MS/MS) with database searching

    • Top-down proteomics for intact protein analysis

  • Post-translational modification identification:

    • Phosphorylation site mapping (TiO2 enrichment followed by MS/MS)

    • Glycosylation analysis (lectins or hydrazide chemistry coupled with MS)

    • Comprehensive PTM screening using multiple enrichment strategies

  • Structural characterization:

    • Hydrogen-deuterium exchange MS for conformational dynamics

    • Chemical cross-linking MS for interface identification

    • Native MS for oligomerization state and complex formation

    • Ion mobility MS for shape and conformational heterogeneity

  • Functional analysis:

    • Activity-based protein profiling coupled with MS

    • Thermal proteome profiling for ligand interactions

    • Protein-protein interaction analysis via crosslinking MS or AP-MS

When designing MS experiments for archaeal proteins like MJ0880, consider the potential for unique post-translational modifications found in archaea but not in bacterial or eukaryotic systems.

How can CRISPR-Cas technologies advance MJ0880 functional studies?

CRISPR-Cas systems offer powerful approaches for functional genomics of uncharacterized proteins:

  • Gene knockout strategies:

    • Develop CRISPR-Cas9 systems optimized for high temperature and archaeal hosts

    • Generate complete gene deletions or frameshift mutations

    • Create conditional knockouts if MJ0880 is essential

    • Analyze resulting phenotypes for functional clues

  • CRISPRi for gene silencing:

    • Use catalytically dead Cas9 (dCas9) for transcriptional repression

    • Design guide RNAs targeting the promoter or coding region

    • Implement inducible systems for temporal control

    • Quantify transcriptional and proteomic changes

  • CRISPR activation systems:

    • Overexpress MJ0880 using dCas9 fused to activation domains

    • Observe gain-of-function phenotypes

    • Analyze metabolic changes through metabolomics

  • Base editing applications:

    • Introduce specific amino acid changes without double-strand breaks

    • Create targeted mutations in putative active sites or binding regions

    • Perform saturation mutagenesis at key residues

  • CRISPR screening approaches:

    • Create guide RNA libraries targeting multiple genes

    • Identify genetic interactions with MJ0880

    • Screen for synthetic lethality or rescue phenotypes

Adapting CRISPR technologies for hyperthermophilic archaea presents technical challenges but offers powerful tools for understanding MJ0880 function in its native context.

What are the implications of MJ0880 for understanding archaeal evolution?

Uncharacterized proteins like MJ0880 can provide insights into archaeal evolution:

  • Comparative genomic analysis:

    • Identify orthologs across archaeal phyla

    • Determine conservation patterns in methanogens versus other archaea

    • Map evolutionary trajectories through phylogenetic reconstruction

    • Identify horizontally transferred elements versus vertically inherited features

  • Domain architecture evolution:

    • Characterize domain shuffling events

    • Identify fusion events with functional implications

    • Compare archaeal-specific versus universal protein domains

  • Selective pressure analysis:

    • Calculate dN/dS ratios across lineages

    • Identify positions under positive or purifying selection

    • Correlate selection patterns with environmental adaptations

  • Ancestral sequence reconstruction:

    • Infer ancestral sequences at key evolutionary nodes

    • Express and characterize reconstructed proteins

    • Compare biochemical properties through evolutionary time

Insights from MJ0880 may contribute to understanding the evolution of metabolic pathways in early life forms and the adaptation of archaea to extreme environments.

How can systems biology approaches integrate MJ0880 into metabolic networks?

For uncharacterized proteins like MJ0880, systems biology offers integrative approaches:

  • Genome-scale metabolic modeling:

    • Incorporate MJ0880 into existing M. jannaschii metabolic models

    • Perform flux balance analysis with different functional assignments

    • Identify metabolic gaps that MJ0880 might fill

    • Validate predictions through targeted metabolomics

  • Multi-omics data integration:

    • Correlate transcriptomic, proteomic, and metabolomic datasets

    • Identify condition-specific regulation patterns

    • Apply network inference algorithms to place MJ0880 in regulatory networks

    • Use Bayesian approaches to integrate heterogeneous data types

  • Constraint-based modeling:

    • Apply thermodynamic constraints specific to hyperthermophilic conditions

    • Incorporate enzyme kinetics data when available

    • Model cellular responses to environmental perturbations

    • Perform sensitivity analysis to identify critical network components

  • Comparative systems biology:

    • Compare network positioning of MJ0880 orthologs across species

    • Identify conserved versus species-specific network modules

    • Map evolutionary adaptations to network architecture changes

These approaches can generate testable hypotheses about MJ0880's role in the broader cellular context of M. jannaschii.

What single-molecule techniques can provide insights into MJ0880 function?

Single-molecule approaches offer unique perspectives on protein function:

  • Single-molecule FRET (smFRET):

    • Monitor conformational changes upon substrate binding

    • Detect interaction dynamics with partner proteins

    • Observe folding/unfolding transitions at different temperatures

    • Identify multiple conformational states invisible in ensemble measurements

  • Optical tweezers or atomic force microscopy:

    • Measure mechanical properties if MJ0880 has structural roles

    • Quantify interaction forces with binding partners

    • Characterize unfolding pathways and stability

  • Single-molecule localization microscopy:

    • Track MJ0880 movement in cells if suitable tagging methods available

    • Determine subcellular localization with nanometer precision

    • Quantify clustering or co-localization with other proteins

  • Nanopore analysis:

    • Detect conformational states through current blockade patterns

    • Observe substrate-induced structural changes

    • Potentially identify binding events with other biomolecules

When applying these techniques to archaeal proteins like MJ0880, consider the need for specialized equipment capable of maintaining high-temperature conditions during measurements.

How should researchers design experimental validation of computational predictions for MJ0880?

Systematic validation of computational predictions requires:

  • Hierarchical validation approach:

    • Begin with in vitro biochemical assays of predicted activities

    • Progress to cellular assays in heterologous hosts

    • Ultimately test in native M. jannaschii if possible

    • Compare results across multiple prediction algorithms

  • Structure-function validation:

    • Generate point mutations in predicted functional residues

    • Create truncations to isolate predicted domains

    • Perform site-directed mutagenesis of predicted binding sites

    • Express chimeric proteins to test domain functionality

  • Interaction validation:

    • Confirm predicted protein-protein interactions through multiple methods

    • Verify predicted small molecule interactions via binding assays

    • Test predicted enzymatic activities with purified components

    • Evaluate predicted regulatory relationships through expression analysis

  • Network-level validation:

    • Assess metabolic predictions through targeted metabolomics

    • Verify pathway involvement through metabolic flux analysis

    • Test predicted regulatory relationships through transcriptomics

    • Validate essentiality predictions through genetic approaches

Each validation experiment should include appropriate controls and statistical analyses to quantify confidence in confirming or rejecting computational predictions.

What ethical considerations should be addressed when publishing research on MJ0880?

Although basic research on archaeal proteins typically presents minimal ethical concerns, researchers should consider:

Ethical research practices ensure that findings related to MJ0880 contribute positively to the scientific community and broader society.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.