Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0945 (MJ0945)

Shipped with Ice Packs
In Stock

Description

Definition and Production

MJ0945 is a recombinant protein derived from M. jannaschii, expressed in Escherichia coli with an N-terminal His tag for purification . Key specifications include:

ParameterValue
Gene NameMJ0945
UniProt IDQ58355
Protein LengthFull-length (1–224 amino acids)
Source OrganismMethanocaldococcus jannaschii
Expression HostE. coli
TagHis (N-terminal)
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C (long-term); 4°C (working aliquots, ≤1 week)

The protein is reconstituted in sterile water to concentrations of 0.1–1.0 mg/mL, often with 50% glycerol for stabilization .

Research Context and Genetic Tools

Recent advancements in M. jannaschii genetic systems have facilitated the study of archaeal proteins like MJ0945. Key developments include:

Genetic Manipulation in M. jannaschii

  • Suicide Plasmid Systems: Plasmids like pDS261 enable homologous recombination to tag endogenous genes (e.g., mj_0748) with affinity sequences (e.g., 3xFLAG-twin Strep tags) under engineered promoters .

  • Protein Purification: Affinity chromatography (e.g., Streptactin XT columns) achieves high yields (e.g., 0.26 mg/L culture for Mj-FprA), enabling biochemical studies .

Current Knowledge Gaps and Challenges

AspectStatus
Functional RoleUncharacterized; no known homology to annotated enzymes or structural proteins .
InteractionsNo reported protein interactions or pathway associations .
Catalytic ActivityNot tested; structural similarity to other archaeal proteins is insufficient for functional inference .

Future Directions

  1. Structural Biology: X-ray crystallography or cryo-EM to resolve MJ0945’s 3D structure and identify catalytic sites.

  2. Omic Approaches: Proteomics or metabolomics to map MJ0945’s role in M. jannaschii’s hydrogenotrophic methanogenesis .

  3. Biotechnological Applications: Engineering MJ0945 for industrial processes, leveraging M. jannaschii’s thermophilic adaptations .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Should you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ0945; Uncharacterized protein MJ0945
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0945
Target Protein Sequence
MLLRQYINVPRLGEIMNLKELTVILIIPIVYLGVCGCFEIVPKSFYDNFSSYNVGDKAPF GEWKVKEGGFKIEAILSEDKKTLNKVAVPINNGIIYIDKNYTDFKFIVDIKRLEESDSPK IYFRLINNANAGYYIDIEGFDRGYVLYKFNGTKVEKLAESYDAAPAGTDFYRYEVVAKDN KIIFLAGGQKYIEYTDNNTPILKGGIGIGGGRAYYDNVRVEPIE
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0945

STRING: 243232.MJ_0945

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the genomic context of MJ0945 in Methanocaldococcus jannaschii?

MJ0945 is one of the numerous genes identified in the M. jannaschii genome, which was the first archaeal genome to be completely sequenced in 1996. M. jannaschii is a hyperthermophilic methanogen isolated from a deep-sea hydrothermal vent, representing one of the most ancient respiratory metabolisms on Earth. The genomic analysis revealed that approximately 60% of M. jannaschii genes had no assigned predicted function at the time of sequencing . As with many archaeal genes, understanding the genomic context of MJ0945 requires examination of its surrounding genes, potential operonic structure, and comparative analysis with other archaeal genomes to identify potential functional relationships.

What expression systems are available for recombinant production of MJ0945?

For recombinant production of MJ0945, researchers now have two main options:

What are the fundamental challenges in characterizing hyperthermophilic archaeal proteins like MJ0945?

Characterizing hyperthermophilic archaeal proteins presents several unique challenges:

  • Temperature stability requirements: Experimental procedures must maintain protein stability at high temperatures (M. jannaschii grows optimally at around 85°C) .

  • Native folding challenges: Ensuring proper protein folding when expressed in mesophilic hosts can be problematic, often resulting in inclusion bodies or misfolded proteins.

  • Post-translational modifications: Archaea have unique post-translational modification systems that may not be replicated in heterologous expression systems.

  • Enzymatic assay conditions: Activity assays need to be performed under high-temperature conditions with appropriate controls.

  • Structural analysis complexity: Traditional structural determination methods may require modifications to account for the extreme stability and unique properties of hyperthermophilic proteins.

The recent development of genetic tools for M. jannaschii helps address some of these challenges by enabling homologous expression, which can preserve native folding and post-translational modifications .

How can genetic manipulation techniques be applied to study MJ0945 function in vivo?

The recently developed genetic system for M. jannaschii provides powerful tools for studying MJ0945 function in vivo through several approaches:

  • Gene knockout studies: The function of MJ0945 can be investigated by creating a knockout strain using the double recombination process. This involves constructing a suicide plasmid containing upstream and downstream regions of the MJ0945 gene flanking a selection marker (like the P₍ₛₗₐ₎-hmgA cassette that confers mevinolin resistance) . Linearized plasmid transformation and subsequent selection on mevinolin-containing media would yield colonies where MJ0945 has been replaced by the selection marker. Phenotypic analysis of this knockout strain compared to wild-type would provide insights into the protein's physiological role.

  • Affinity-tagged version creation: As demonstrated with the FprA protein (Mj_0748), MJ0945 can be modified to include affinity tags such as FLAG or Strep tags . This approach would facilitate:

    • Protein purification using affinity chromatography

    • Co-immunoprecipitation studies to identify interaction partners

    • Subcellular localization studies using tag-specific antibodies

  • Promoter replacement: The native promoter of MJ0945 can be replaced with a stronger promoter (such as P₍ᵣᵤᵦⱼ₎) for overexpression studies or with a regulatable promoter for controlled expression experiments .

The transformation protocol requires heat shock treatment of M. jannaschii cells with the DNA, followed by selection on solid media containing appropriate antibiotics. Colonies typically form within 3-4 days, which is significantly faster than for other methanogenic archaea .

What computational approaches are recommended for predicting the function of MJ0945?

Several computational approaches can be employed for predicting MJ0945 function:

  • Sequence-based analysis:

    • PSI-BLAST for distant homology detection

    • Hidden Markov Model profiles for domain prediction

    • Analysis of conserved motifs across archaeal species

  • Structural prediction:

    • AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Structure-based function prediction through fold recognition

    • Active site prediction and comparison with known enzymes

  • Epistasis-based approaches: Recent experimental and computational advances allow for detecting functional relationships through epistatic interactions . This approach involves:

    • Creating sequence libraries with varying degrees of mutations from the wild-type

    • Analyzing the co-evolution of amino acid positions

    • Applying plmDCA (pseudolikelihood maximization Direct Coupling Analysis) or evCouplings methods to detect epistatic relationships

    • Using these relationships to predict structural contacts

  • Data-driven sequence landscape modeling: As described in search result , researchers can develop a computational framework that:

    • Simulates protein evolution in a data-driven sequence landscape

    • Models sequence-space exploration

    • Predicts the emergence of epistatic signals with sequence divergence

    • Helps optimize experimental design for protein characterization

The optimal approach would combine multiple computational methods, followed by experimental validation using the genetic system described above.

How can high-throughput approaches be utilized to characterize the biochemical properties of MJ0945?

High-throughput characterization of MJ0945 can employ several advanced approaches:

  • Proteomic interaction studies:

    • Affinity purification coupled with mass spectrometry (AP-MS) using tagged MJ0945

    • Protein microarrays with M. jannaschii proteome to identify interaction partners

    • Crosslinking mass spectrometry to capture transient interactions

  • Functional screening:

    • Activity-based protein profiling using chemical probes

    • Substrate screening using metabolite libraries

    • Phenotypic screening of MJ0945 variants in knockout complementation experiments

  • Evolutionary and mutational analysis:

    • Deep mutational scanning to map sequence-function relationships

    • Directed evolution to identify functionally important residues

    • Comparison of sequences across archaea to identify conserved regions

  • Structural studies under native conditions:

    • Cryo-electron microscopy for structure determination while maintaining native interactions

    • Hydrogen-deuterium exchange mass spectrometry for dynamics and interaction studies

    • Native mass spectrometry for oligomeric state determination

Each of these approaches can generate large datasets that, when integrated, provide a comprehensive understanding of MJ0945's biochemical properties and cellular functions.

What are the optimal conditions for expressing and purifying recombinant MJ0945?

Based on successful strategies with other M. jannaschii proteins (such as FprA/Mj_0748), the following conditions are recommended:

  • Expression system selection:

    • Homologous expression in M. jannaschii BM31-like strain: This approach uses the recently developed genetic system where the gene is coupled with affinity tags and expressed under control of an engineered promoter . This system produced functional FprA protein with a yield of 0.26 mg purified protein per liter culture.

    • Growth conditions: Anaerobic cultivation at 80-85°C in modified marine medium under H₂/CO₂ (80:20) atmosphere

  • Affinity tag design:

    • Recommended tags: 3xFLAG-twin Strep tag combination has been successfully used for M. jannaschii proteins

    • Tag position: N-terminal tagging is preferable unless structural data suggests C-terminal availability

    • Linker: Flexible glycine-serine linkers (GGGGS)₂ between protein and tags

  • Purification protocol:

    • Initial capture: Streptactin XT superflow column chromatography

    • Elution: 10 mM D-biotin in anaerobic buffer

    • Secondary purification: Size exclusion chromatography or ion exchange as needed

    • Buffer conditions: Reducing conditions (typically 1-5 mM DTT or 2-mercaptoethanol) to prevent oxidation of cysteine residues

  • Quality control methods:

    • SDS-PAGE for purity assessment

    • Western blot using monoclonal anti-FLAG antibodies to confirm tag presence

    • Mass spectrometry for identity confirmation and detection of post-translational modifications

    • Activity assays appropriate to predicted function

This strategy should be optimized specifically for MJ0945 based on its unique properties and predicted function.

How can researchers address the challenge of protein stability when working with hyperthermophilic proteins like MJ0945?

Working with hyperthermophilic proteins requires specific adaptations to standard protocols:

  • Buffer optimization strategies:

    • Higher salt concentrations (typically 200-500 mM NaCl or KCl)

    • Addition of compatible solutes (e.g., di-myo-inositol phosphate, mannosylglycerate)

    • Inclusion of reducing agents to prevent cysteine oxidation

    • pH maintenance at optimal range (typically pH 6.5-7.5)

  • Temperature considerations:

    • Performing purification steps at elevated temperatures when possible

    • Using thermostable chromatography resins and equipment

    • Designing activity assays at temperatures relevant to physiological conditions (70-85°C)

    • Temperature gradient experiments to determine optimal conditions

  • Storage and handling:

    • Flash-freezing in liquid nitrogen with cryoprotectants

    • Addition of glycerol (10-20%) for frozen storage

    • Limiting freeze-thaw cycles

    • Testing stability at different pH values and buffer compositions

  • Characterization under native conditions:

    • Differential scanning calorimetry to determine melting temperature

    • Circular dichroism at varying temperatures to monitor structural integrity

    • Activity assays at multiple temperatures to establish thermal activity profile

    • Dynamic light scattering to monitor aggregation state

These approaches have been successfully applied to other M. jannaschii proteins and should be adapted specifically for MJ0945 based on initial characterization results.

What experimental controls are essential when characterizing the function of MJ0945?

Robust experimental design for MJ0945 characterization requires several critical controls:

  • Genetic validation controls:

    • Wild-type M. jannaschii: Essential baseline for comparing phenotypic changes

    • Complementation strain: MJ0945 knockout complemented with wild-type gene to confirm phenotype rescue

    • Empty vector control: For heterologous expression systems

    • PCR verification: To confirm genetic manipulations using primers targeting genomic regions

  • Protein quality controls:

    • Affinity tag-only construct: To identify tag-related artifacts

    • Heat-denatured protein: Negative control for activity assays

    • Known functional homolog: Positive control for comparative studies

    • Mass spectrometry analysis: To verify protein identity and modifications

  • Activity assay controls:

    • No-substrate control: To measure background activity

    • No-enzyme control: To account for non-enzymatic reactions

    • Temperature gradients: To establish optimal temperature for activity

    • Substrate specificity controls: Testing related substrates to establish specificity

  • Interaction study controls:

    • Non-specific binding controls: Using non-related tagged proteins

    • Competitive binding assays: To confirm specificity of interactions

    • In vivo validation: Confirming in vitro interactions through co-localization or other methods

How can researchers differentiate between direct and indirect effects when studying MJ0945 knockouts?

Differentiating between direct and indirect effects in MJ0945 knockout studies requires a multi-faceted approach:

  • Complementation analysis:

    • Reintroduction of wild-type MJ0945 to restore function

    • Introduction of point mutants to identify critical residues

    • Expression of homologs from related species to test functional conservation

  • Multi-omics integration:

    • Transcriptomics: RNA-seq to identify differentially expressed genes

    • Proteomics: Quantitative proteomics to detect protein level changes

    • Metabolomics: Targeted and untargeted analysis of metabolite changes

    • Network analysis: Pathway enrichment to identify affected biological processes

  • Temporal resolution studies:

    • Time-course experiments following knockout induction

    • Early vs. late effect differentiation

    • Kinetic modeling of affected pathways

  • Conditional knockout approaches:

    • Using regulatable promoters for controlled expression

    • Studying phenotypes under different growth conditions

    • Testing epistatic relationships with other genes

By combining these approaches, researchers can build a causal model distinguishing primary effects directly resulting from MJ0945 absence from secondary adaptations or compensatory responses.

What statistical methods are most appropriate for analyzing high-throughput data generated from MJ0945 studies?

The analysis of high-throughput data from MJ0945 studies requires specific statistical approaches depending on the experimental design:

  • Differential expression analysis (for transcriptomics/proteomics):

    • DESeq2 or edgeR for RNA-seq count data

    • LIMMA for proteomics data

    • Multiple testing correction using Benjamini-Hochberg procedure

    • Significance thresholds: adjusted p-value < 0.05 and fold change > 1.5

  • Interaction network analysis:

    • Significance Analysis of INTeractome (SAINT) for AP-MS data

    • Hypergeometric tests for enrichment analysis

    • Network visualization using Cytoscape

    • Community detection algorithms to identify functional modules

  • Sequence-function relationship analysis:

    • Regression models for mapping sequence features to functional outcomes

    • Direct Coupling Analysis (DCA) for detecting epistatic interactions

    • Machine learning approaches (random forests, neural networks) for complex patterns

    • Cross-validation and permutation tests to assess model robustness

  • Evolutionary sequence analysis:

    • Maximum likelihood methods for phylogenetic reconstruction

    • dN/dS analysis for selection pressure estimation

    • Sequence-space exploration models as described in search result

    • Statistical testing for co-evolution between residues

How can researchers resolve conflicting results when characterizing MJ0945?

Resolving conflicting results in protein characterization studies requires systematic troubleshooting:

  • Methodological reconciliation:

    • Technical replication: Repeat experiments with identical conditions

    • Methodological variation: Apply alternative techniques to measure the same parameter

    • Independent validation: Have different researchers or laboratories replicate key experiments

    • Reagent validation: Test different batches of reagents, substrates, or enzyme preparations

  • Condition-dependent effects investigation:

    • Temperature-dependent behavior: Test function across a temperature range

    • pH dependence: Evaluate activity at different pH values

    • Buffer composition effects: Systematically vary salt concentrations and additives

    • Redox state influence: Test under varying reducing/oxidizing conditions

  • Data integration and model refinement:

    • Bayesian approaches: Update confidence in hypotheses based on cumulative evidence

    • Meta-analysis: Formal statistical integration of multiple experimental results

    • Computational simulation: Use in silico approaches to reconcile conflicting data

    • Alternative hypotheses formulation: Develop models that account for seemingly contradictory results

  • Experimental design optimization:

    • Analyze the strength of selection used in experiments, as search result suggests that weaker selection might be beneficial for exploring sequence space and detecting epistatic interactions

    • Adjust sequencing depth and sequence divergence in evolutionary studies based on simulation predictions

    • Consider alternating cycles of strong and weak selection to optimize experimental outcomes

This systematic approach helps distinguish genuine biological complexity from technical artifacts when characterizing proteins like MJ0945.

How might MJ0945 contribute to our understanding of archaeal evolution and adaptation to extreme environments?

As an uncharacterized protein from one of the most deeply rooted archaeal species, MJ0945 offers unique insights into evolution:

  • Phylogenetic analysis potential:

    • MJ0945 may represent an ancient protein family predating the divergence of archaea and bacteria

    • Comparative analysis across domains could reveal fundamental aspects of protein evolution

    • Study of MJ0945 homologs in different archaeal phyla might illuminate archaeal evolutionary history

  • Adaptation mechanisms to extreme environments:

    • Structural features contributing to thermostability could reveal principles of protein adaptation to high temperatures

    • Potential roles in stress response pathways specific to hydrothermal vent environments

    • Insights into adaptations to high pressure, fluctuating temperatures, or variable redox conditions

  • Ancient metabolic capabilities:

    • If involved in methanogenesis, MJ0945 could provide insights into one of the earliest respiratory metabolisms on Earth (estimated to have developed 3.49 billion years ago)

    • Potential involvement in unique archaeal metabolic pathways

    • Insights into minimal requirements for life in extreme environments

  • Horizontal gene transfer assessment:

    • Analysis of MJ0945 distribution could reveal patterns of horizontal gene transfer among archaea or between domains

    • Identification of selective pressures driving gene conservation or transfer

    • Insights into the evolution of archaeal genomes

Understanding MJ0945 could contribute significantly to our knowledge of how life adapted to extreme environments early in Earth's history.

What innovative approaches can be used to establish structure-function relationships for MJ0945?

Cutting-edge approaches for establishing MJ0945 structure-function relationships include:

  • Integrative structural biology:

    • Combining cryo-EM, X-ray crystallography, and NMR for comprehensive structural characterization

    • Molecular dynamics simulations at high temperatures to understand conformational stability

    • Hydrogen-deuterium exchange mass spectrometry to probe structural dynamics

    • Time-resolved structural methods to capture conformational changes during function

  • Advanced mutagenesis strategies:

    • Deep mutational scanning to comprehensively map sequence-function relationships

    • Ancestral sequence reconstruction to test evolutionary hypotheses

    • Computational design of stabilized variants for easier structural studies

    • Site-specific incorporation of unnatural amino acids to probe mechanism

  • High-resolution functional mapping:

    • Single-molecule enzymology at elevated temperatures

    • In-cell structural studies using genetic code expansion

    • Chemical crosslinking combined with mass spectrometry for interaction mapping

    • CRISPR interference for targeted regulation of MJ0945 expression

  • Machine learning applications:

    • Graph neural networks to predict functional effects of mutations

    • Sequence-based function prediction using transformer models

    • Integration of structural and functional data through multi-modal deep learning

    • Simulation of sequence-space exploration and epistasis emergence as described in search result

These approaches, especially when combined, can provide unprecedented insights into MJ0945 structure and function relationships.

How can the genetic system for M. jannaschii be optimized for studying proteins like MJ0945?

The recently developed genetic system for M. jannaschii can be optimized for MJ0945 studies in several ways:

  • Selection marker improvements:

    • Development of additional selectable markers beyond mevinolin/simvastatin resistance

    • Implementation of counterselectable markers for markerless mutations

    • Development of inducible selection systems for conditional mutants

    • Creation of fluorescent protein reporters functional at high temperatures

  • Transformation efficiency enhancements:

    • Optimization of DNA delivery methods for higher efficiency

    • Investigation of restriction-modification systems that might limit transformation

    • Development of shuttle vectors capable of replication in both E. coli and M. jannaschii

    • Establishment of protocols for introducing larger DNA constructs

  • Expression system refinements:

    • Characterization and optimization of promoter strength and regulation

    • Development of inducible promoter systems for controlled expression

    • Optimization of ribosome binding sites for improved translation efficiency

    • Investigation of untranslated regions affecting mRNA stability

  • Advanced genome editing approaches:

    • Adaptation of CRISPR-Cas systems for M. jannaschii

    • Development of recombineering approaches for precise genome editing

    • Implementation of multiplex genome editing for studying gene families

    • Creation of genome-wide knockout libraries for functional genomics

As suggested in search result , computational modeling of experimental parameters could help optimize protocols, identifying conditions that maximize the probability of successful characterization while minimizing experimental costs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.