Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0953 (MJ0953)

What is currently known about the uncharacterized protein MJ0953?

MJ0953 is an uncharacterized protein from M. jannaschii with UniProt accession number Q58363 . The protein consists of 100 amino acids with the sequence: MRLLGVIGYLAVLIKAICESWVDVVKRSINGEIHPQVIEIESIINNPTGLVLLSWSITATPGTLVIDLIPEERKLKVAVISPRSREDIVPFEPYIKKIFD . Despite being uncharacterized, sequence analysis suggests it may contain a transmembrane domain based on the presence of hydrophobic amino acid stretches. The gene is designated as MJ0953 in the M. jannaschii genome . As with many uncharacterized proteins, its biological function, structure, and role in M. jannaschii metabolism remain to be elucidated through experimental approaches.

How does the extreme environment of M. jannaschii potentially influence the structure and function of proteins like MJ0953?

Proteins from hyperthermophilic organisms like M. jannaschii typically exhibit remarkable thermal stability to function optimally in extreme conditions. This stability often results from several structural adaptations:

• Increased number of salt bridges and hydrogen bonds

• Higher proportion of hydrophobic amino acids in the protein core

• Reduced number of thermolabile residues

• More compact folding with fewer surface loops

• Enhanced oligomerization

These adaptations may apply to MJ0953, potentially making it unusually stable at high temperatures. Additionally, proteins from organisms living at high hydrostatic pressures (barophiles) often show structural modifications that maintain functionality under compression. Since M. jannaschii was isolated from deep-sea vents at 2600m depth , MJ0953 might possess structural features that enable function under both high temperature and pressure conditions. Understanding these adaptations can provide insights into protein evolution and potential biotechnological applications of extremophile proteins.

What expression systems are most effective for recombinant production of M. jannaschii proteins like MJ0953?

Several expression systems can be employed for recombinant production of M. jannaschii proteins, each with specific advantages:

Homologous expression in M. jannaschii:

• Provides the most native-like conditions for proper folding and post-translational modifications

• Requires specialized equipment for high-temperature, high-pressure cultivation

• Genetic tools for M. jannaschii have been developed, including transformation protocols using heat shock at 85°C for 45 seconds followed by incubation at 4°C

• Affinity tags such as 3xFLAG-Twin Strep can be incorporated for easier purification

• Solid medium using Gelrite® as a gelling agent supplemented with cysteine or titanium (III) citrate has been developed for selecting transformants

Heterologous expression in mesophilic hosts:

• E. coli systems: While commonly used, may require optimization for thermophilic proteins

• Cold-shock inducible systems can reduce inclusion body formation

• Co-expression with chaperones from thermophilic organisms may improve folding

• Use of specialized E. coli strains adapted for archaeal codon usage

What purification strategies are most effective for thermostable proteins from M. jannaschii?

Purification of thermostable proteins from M. jannaschii can leverage their inherent heat stability through these strategies:

Heat treatment:

• Initial purification step exploiting thermal stability

• Heating crude extracts to 70-80°C for 15-30 minutes denatures most mesophilic host proteins while thermostable target proteins remain soluble

• Centrifugation removes denatured proteins, providing significant initial purification

Affinity chromatography:

• Fusion tags like His-tag, FLAG-tag, or Strep-tag facilitate purification

• For MJ0953, a Twin Strep tag system has been used with elution using 10 mM D-biotin

• Yields of 0.26 mg purified protein per liter of culture have been reported for similar M. jannaschii proteins

Conventional chromatography:

• Ion exchange chromatography at higher temperatures (40-60°C) can maintain native protein structure

• Hydrophobic interaction chromatography exploiting unique surface properties of thermophilic proteins

• Size exclusion chromatography for final polishing steps

Buffer considerations:

• Use of reducing agents (DTT, β-mercaptoethanol) to prevent oxidation of cysteine residues

• Stabilizing additives like glycerol or specific ions found in the native environment

• pH optimization based on the protein's isoelectric point

The choice of strategy should be tailored to the specific properties of MJ0953, with preliminary experiments to determine its behavior under various conditions.

How can I assess the quality and native folding of purified recombinant MJ0953?

Assessing the quality and native folding of purified recombinant MJ0953 requires a multi-technique approach:

Biophysical characterization:

• Circular dichroism (CD) spectroscopy at different temperatures to assess secondary structure content and thermal stability

• Differential scanning calorimetry (DSC) to determine melting temperature and conformational stability

• Dynamic light scattering (DLS) to evaluate homogeneity and aggregation state

• Intrinsic fluorescence spectroscopy to monitor tertiary structure integrity

Functional characterization:

• Activity assays (once function is determined)

• Ligand binding studies using isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR)

• Protein-protein interaction studies if binding partners are identified

Structural analysis:

• Limited proteolysis to identify flexible regions and core domains

• Crystallization trials for X-ray crystallography

• NMR spectroscopy for solution structure determination

• Cryo-electron microscopy for larger complexes

Quality control metrics:

• SDS-PAGE for purity assessment (as demonstrated for other M. jannaschii proteins)

• Western blotting to confirm identity using anti-tag antibodies

• Mass spectrometry for accurate molecular weight determination and verification of primary structure

• Peptide mass fingerprinting, which has been successfully used to verify the identity of other M. jannaschii proteins with 55% sequence coverage

For thermostable proteins like MJ0953, these analyses should ideally be performed at both standard laboratory temperatures and at elevated temperatures that mimic the native environment.

What computational approaches can predict potential functions of uncharacterized proteins like MJ0953?

Computational approaches offer valuable insights into potential functions of uncharacterized proteins through various predictive methods:

Sequence-based analysis:

• Homology detection using PSI-BLAST or HHpred to identify distant relatives

• Motif scanning using InterProScan or PROSITE for functional domains

• Transmembrane topology prediction using TMHMM or Phobius

• Signal peptide prediction using SignalP

• Conserved residue analysis through multiple sequence alignments

Structural prediction:

• Ab initio structure prediction using Rosetta or AlphaFold

• Secondary structure prediction using PSIPRED or JPred

• Fold recognition using threading approaches (e.g., I-TASSER)

• Protein-protein interaction site prediction using SPPIDER or PredUs

Genomic context analysis:

• Gene neighborhood analysis to identify functionally related genes

• Co-expression analysis if transcriptomic data is available

• Phylogenetic profiling to identify co-evolving proteins

• Analysis of M. jannaschii metabolic pathways for potential roles

Integration approaches:

• Protein function prediction servers like COFACTOR or ProFunc

• Gene Ontology term prediction

• Enzyme classification prediction if enzymatic function is suspected

For MJ0953 specifically, preliminary analysis of its amino acid sequence (MRLLGVIGYLAVLIKAICESWVDVVKRSINGEIHPQVIEIESIINNPTGLVLLSWSITATPGTLVIDLIPEERKLKVAVISPRSREDIVPFEPYIKKIFD) suggests hydrophobic regions that may indicate membrane association, which could be a starting point for functional hypothesis generation.

What experimental techniques are most effective for determining the function of uncharacterized archaeal proteins?

Determining the function of uncharacterized archaeal proteins requires a systematic experimental approach:

Genetic techniques:

• Gene knockout or knockdown to observe phenotypic effects

• Complementation studies in related species

• Genetic system for M. jannaschii has been developed allowing chromosome-based homologous expression

• Promoter fusion studies to understand expression patterns

Biochemical approaches:

• In vitro activity assays testing potential enzymatic functions

• Substrate screening panels to identify potential reactants

• Metabolite profiling in native vs. mutant strains

• Protein-protein interaction studies using pull-down assays

• Chemical crosslinking followed by mass spectrometry (XL-MS)

Structural biology:

• X-ray crystallography or cryo-EM to determine 3D structure

• NMR spectroscopy to identify ligand binding sites

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify dynamic regions and binding interfaces

Systems biology:

• Transcriptomic analysis under various conditions

• Proteomic profiling to identify co-regulated proteins

• Metabolomic changes in response to gene manipulation

Specialized archaeal techniques:

• Development of archaeal-specific vectors and selection markers

• Use of mevinolin resistance for selection in M. jannaschii transformants

• Growth on solid medium containing Gelrite® supplemented with cysteine or titanium (III) citrate

For uncharacterized proteins like MJ0953, a combination of these approaches is typically necessary, starting with computational predictions to guide experimental design.

How can I investigate the thermal stability and activity profile of MJ0953 across different temperatures?

Investigating thermal stability and activity profile of MJ0953 requires techniques that can operate across a wide temperature range:

Thermal stability assessment:

Activity measurements at elevated temperatures:

• Custom high-temperature reaction vessels with thermostable pH electrodes

• Stopped-flow systems with temperature control for kinetic measurements

• Oxygen reduction activity measurements at 70°C have been performed for other M. jannaschii proteins with F420H2 as reductant

• Specific activity measurements in temperature-controlled spectrophotometers

Stability kinetics:

• Time-course incubation studies at different temperatures (60°C, 70°C, 80°C, 90°C)

• Sampling at regular intervals to determine half-life at each temperature

• Arrhenius plot analysis to determine activation energy of denaturation

Buffer and additive optimization:

• Screening buffer compositions that maintain stability at high temperatures

• Testing stabilizing additives (salts, polyols, sugars) at different concentrations

• Mimicking the ionic composition of the native environment

For MJ0953, experiments should be designed considering M. jannaschii's optimal growth temperature of 80°C , with activity measurements ideally performed at both standard laboratory temperatures and at temperatures matching the native environment.

How can genetic systems for M. jannaschii be applied to study MJ0953 function in vivo?

Genetic manipulation systems for M. jannaschii offer powerful approaches to study MJ0953 function in its native context:

Homologous recombination system:

• Linear suicide vectors can be used for genome modification through double crossover homologous recombination

• Mevinolin resistance markers enable selection of transformants

• A demonstrated transformation protocol involves:

  • Cell harvesting at OD600 of 0.5-0.7 (2-4 × 10^8 cells/ml)

  • Resuspension in pre-reduced medium containing sodium sulfide

  • Incubation with linearized DNA at 4°C for 30 minutes

  • Heat shock at 85°C for 45 seconds

  • Recovery at 80°C overnight

MJ0953 functional studies:

• Promoter replacement to control expression levels

• Addition of affinity tags (3xFLAG-Twin Strep) for pull-down experiments

• Gene deletion to observe phenotypic effects

• Site-directed mutagenesis to identify essential residues

Reporter systems:

• Fusion of MJ0953 to reporter genes to study localization

• Development of thermostable reporters appropriate for M. jannaschii growth conditions

• Promoter fusion studies to understand expression patterns

Advantages of homologous systems:

• Native post-translational modifications are preserved

• Natural protein-protein interactions are maintained

• Physiological relevance of findings is increased

• Avoid artifacts associated with heterologous expression

The development of solid medium for M. jannaschii using Gelrite® as a gelling agent supplemented with additional reducing agents (cysteine or titanium (III) citrate) enables the isolation of clonal transformants within 3-4 days, which is significantly faster than other methanogenic systems .

What comparative genomic approaches can provide insights into the evolutionary significance of MJ0953?

Comparative genomic approaches can reveal evolutionary patterns and potential functions of MJ0953 through systematic analysis:

Phylogenetic profiling:

• Identifying presence/absence patterns of MJ0953 homologs across species

• Correlation with environmental adaptations (temperature, pressure, pH)

• Co-evolution with other genes suggesting functional relationships

Synteny analysis:

• Examining conservation of gene order around MJ0953

• Identifying operonic structures suggesting co-regulation

• Detecting horizontally transferred genomic islands

Sequence conservation analysis:

• Multiple sequence alignment of MJ0953 homologs

• Identification of absolutely conserved residues suggesting functional importance

• Detection of selective pressure through Ka/Ks ratio analysis

• Coevolution analysis to identify residues that may interact

Structure-based phylogeny:

• Comparing predicted structural features across homologs

• Identification of conserved structural motifs despite sequence divergence

• Mapping of conserved surface patches that may indicate interaction sites

Data integration approaches:

• Correlation of MJ0953 presence with specific metabolic pathways

• Analysis of expression patterns across different growth conditions

• Integration with protein-protein interaction networks

These comparative approaches can place MJ0953 in an evolutionary context, potentially revealing its role in archaeal adaptation to extreme environments and providing clues about its function based on associated genes and conservation patterns.

How might studying MJ0953 contribute to understanding archaeal membrane biology and extremophile adaptation?

Studying MJ0953 could significantly advance our understanding of archaeal membrane biology and extremophile adaptation through several research avenues:

Membrane adaptation mechanisms:

• Sequence analysis of MJ0953 suggests potential membrane association

• Archaeal membranes differ fundamentally from bacterial and eukaryotic membranes, featuring ether-linked isoprenoid lipids instead of ester-linked fatty acids

• Thermophilic archaea like M. jannaschii often contain tetraether lipids that form monolayer membranes with exceptional stability

• Characterizing MJ0953's interaction with these unique membranes could reveal novel adaptation mechanisms

Protein stabilization strategies:

• M. jannaschii proteins must function at temperatures of 48-94°C under high pressure

• Understanding how MJ0953 maintains structural integrity under these conditions could reveal general principles of protein thermostabilization

• Comparison with mesophilic homologs could identify specific adaptations

Functional integration with extremophile metabolism:

• M. jannaschii is a methanogen that grows on carbon dioxide and hydrogen

• The role of MJ0953 in this specialized metabolism could provide insights into energy conservation under extreme conditions

• Potential involvement in stress response or protection mechanisms

Biotechnological applications:

• Insights from MJ0953 could guide engineering of thermostable proteins for industrial applications

• Understanding membrane protein adaptation could aid development of robust biosensors

• Novel enzymatic activities optimized for extreme conditions might be discovered

Evolutionary significance:

• The deep evolutionary rooting of M. jannaschii makes it valuable for understanding early life

• MJ0953 might represent a conserved adaptation strategy that emerged early in the evolution of thermophilic archaea

• Analysis could provide insights into the environmental conditions of early Earth

Research on MJ0953 thus sits at the intersection of membrane biology, protein structure-function relationships, and the evolution of life in extreme environments.

What are common challenges in working with recombinant hyperthermophilic proteins and how can they be addressed?

Working with recombinant hyperthermophilic proteins presents several unique challenges that require specialized approaches:

Expression challenges:

• Codon bias differences between thermophiles and mesophilic expression hosts

  • Solution: Use codon-optimized synthetic genes or specialized host strains

• Toxicity to mesophilic hosts due to altered protein-protein interactions

  • Solution: Use tightly controlled inducible systems or secretion strategies

• Improper folding at lower temperatures

  • Solution: Express at higher temperatures (30-42°C) or use thermophilic expression hosts

Purification challenges:

• Different hydrophobicity patterns affecting chromatographic behavior

  • Solution: Adjust buffer compositions and column selection based on pilot experiments

• Unexpected oligomerization states

  • Solution: Include reducing agents and perform size exclusion chromatography

• Interaction with endogenous proteins in the host

  • Solution: Use stringent washing conditions during affinity purification

Activity assessment challenges:

• Standard assay conditions may not reflect optimal activity conditions

  • Solution: Perform assays at elevated temperatures (60-80°C) with thermostable reagents

• Different cofactor requirements from mesophilic counterparts

  • Solution: Supplement with M. jannaschii cellular extract or specific cofactors

• Substrate specificity shifts at different temperatures

  • Solution: Screen multiple substrates at various temperatures

Storage and stability challenges:

• Paradoxical cold-sensitivity of some thermophilic proteins

  • Solution: Store at room temperature or with cryoprotectants

• Loss of activity during freeze-thaw cycles

  • Solution: Aliquot and minimize freeze-thaw cycles; add stabilizing agents

• Oxidation of crucial cysteine residues

  • Solution: Maintain reducing conditions with DTT or β-mercaptoethanol

For MJ0953 specifically, its uncharacterized nature adds complexity since optimal conditions for activity and stability are unknown. Systematic testing of different conditions based on the general properties of M. jannaschii proteins is recommended.

How can I design controls to validate functional hypotheses for an uncharacterized protein like MJ0953?

Designing appropriate controls is crucial for validating functional hypotheses about uncharacterized proteins like MJ0953:

Negative controls:

• Empty vector controls in expression studies

• Site-directed mutagenesis of predicted catalytic residues

• Heat-inactivated protein preparations

• Closely related proteins with different predicted functions

• Samples from deletion mutants (if genetic system is available)

Positive controls:

• Well-characterized proteins with similar predicted domains

• Known enzymes from the same metabolic pathway

• Homologs with established functions from related species

• Complementation with wild-type gene in knockout strains

Validation approaches:

• Orthogonal assays measuring the same activity through different methods

• Dose-response relationships showing concentration dependence

• Substrate specificity profiles comparing related molecules

• Inhibitor studies with competitive and non-competitive inhibitors

• Rescue experiments demonstrating restoration of function

Structural validation:

• Correlation between structural changes and functional effects

• Ligand binding studies with predicted substrates

• Mapping of interaction interfaces through mutagenesis

Expression-level controls:

• Quantitative Western blotting to normalize activity to protein levels

• Internal standards for activity measurements

• Isogenic strains differing only in the MJ0953 locus

A systematic approach would start with computational predictions to guide initial hypothesis formation, followed by biochemical assays with appropriate controls, and culminate in genetic validation using the established M. jannaschii genetic system .

What specialized equipment and methodology considerations are necessary for working with proteins from hyperthermophiles?

Working with proteins from hyperthermophiles like M. jannaschii requires specialized equipment and methodological adaptations:

Growth and cultivation equipment:

• High-temperature incubators capable of maintaining 80°C consistently

• Pressure vessels for simulating native deep-sea conditions

• Specialized anaerobic chambers for handling strict anaerobes like M. jannaschii

• Gas delivery systems for H2 and CO2 mixtures (80:20, v/v) at 3 × 10^5 Pa

• Shaker incubators rated for high temperature operation (80°C at 200 rpm)

Analytical equipment modifications:

• Temperature-controlled spectrophotometers with extended range (up to 95°C)

• Heat-resistant cuvettes and reaction vessels

• High-temperature water baths for enzyme assays

• Thermal cyclers with extended high-temperature holds

• DSC instruments capable of measurements above 100°C

Purification considerations:

• Temperature-controlled FPLC systems

• Column materials stable at higher temperatures

• Heat-resistant centrifuge rotors and tubes

• Buffers with temperature-compensated pH values

Reagent and media considerations:

• Thermostable reducing agents (e.g., titanium (III) citrate rather than DTT)

• Additional reducing agents for solid media (cysteine at 2 mM or titanium (III) citrate at 0.14 mM)

• Use of Gelrite® instead of agar for solid media preparation

• Pre-reduced media containing sodium sulfide for anaerobic conditions

• Selection markers effective at high temperatures (e.g., mevinolin resistance)

Safety considerations:

• Enhanced ventilation for working with hydrogen gas mixtures

• Heat-resistant gloves and handling equipment

• Specialized disposal protocols for pressure vessels and gas cylinders

• Proper precautions for handling anaerobic cultures

These specialized requirements make working with hyperthermophilic proteins more challenging but are essential for maintaining native-like conditions and obtaining physiologically relevant results.

What emerging technologies might advance our understanding of uncharacterized proteins like MJ0953?

Several cutting-edge technologies are poised to revolutionize our understanding of uncharacterized proteins like MJ0953:

AI-driven structural prediction:

• AlphaFold and RoseTTAFold can now predict protein structures with near-experimental accuracy

• Integration with molecular dynamics simulations for functional insights

• Protein-protein and protein-ligand interaction predictions

• Active site identification through structural analyses

Single-molecule techniques:

• FRET-based approaches to monitor conformational changes at high temperatures

• Optical tweezers to study protein folding under extreme conditions

• Nanopore technologies for analyzing membrane proteins

• Super-resolution microscopy for in vivo localization studies

Advanced mass spectrometry:

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for mapping dynamics

• Crosslinking mass spectrometry (XL-MS) for protein interaction networks

• Native mass spectrometry for studying intact complexes

• Protein footprinting to identify ligand binding sites

Genome editing technologies:

• CRISPR-Cas systems adapted for archaeal organisms

• Multiplex automated genome engineering (MAGE) for creating variant libraries

• Saturation mutagenesis approaches to map structure-function relationships

• Single-cell genomics to study population heterogeneity

Microfluidic systems:

• High-pressure microfluidic devices mimicking deep-sea conditions

• Temperature-gradient platforms for optimal condition screening

• Droplet-based enzyme assays for high-throughput functional screening

• Cell-free expression systems in microfluidic formats

These technologies, when adapted for the extreme conditions required for M. jannaschii proteins, could provide unprecedented insights into the function and evolutionary significance of uncharacterized proteins like MJ0953, potentially revealing novel biochemical activities and adaptation mechanisms.

How might research on MJ0953 contribute to broader questions in evolutionary biology and astrobiology?

Research on MJ0953 could provide significant insights into fundamental questions in evolutionary biology and astrobiology:

Early life evolution:

• Archaea represent one of the earliest branches of life on Earth

• M. jannaschii, as a deeply rooted hyperthermophile, may possess protein features that reflect early evolutionary adaptations

• MJ0953 could preserve ancestral structural or functional characteristics

Convergent evolution under extreme conditions:

• Comparison of MJ0953 with proteins from unrelated extremophiles

• Identification of similar adaptation strategies across diverse lineages

• Understanding constraints and solutions in protein evolution under extreme conditions

Molecular basis of thermophily:

• Detailed structural analysis of how MJ0953 maintains stability at high temperatures

• Identification of specific amino acid compositions and structural features

• Comparison with mesophilic homologs to identify key adaptations

Astrobiological implications:

• Hydrothermal vents similar to M. jannaschii's habitat are considered potential sites for life's origin

• Understanding how proteins function in these environments informs models of early Earth

• Potential analogues to environments on other celestial bodies (e.g., Europa, Enceladus)

• M. jannaschii has been studied in astrobiology research projects looking at methane-producing bacteria

Limits of biochemistry:

• Exploring the boundaries of protein function under extreme conditions

• Understanding adaptations that push the limits of known biochemistry

• Insights into the potential diversity of life beyond Earth

By characterizing this uncharacterized protein from a deeply rooted archaeon, researchers may gain valuable perspectives on protein evolution, adaptation to extreme environments, and the biochemical possibilities available to early life, with implications extending to our search for life beyond Earth.

What interdisciplinary approaches could accelerate functional characterization of MJ0953?

Accelerating the functional characterization of MJ0953 requires integrating multiple scientific disciplines:

Integrative structural biology:

• Combining X-ray crystallography, cryo-EM, and NMR

• Integrating computational modeling with experimental validation

• Molecular dynamics simulations under extreme conditions

• Small-angle X-ray scattering (SAXS) for solution structure determination

Systems biology approaches:

• Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

• Network analysis to place MJ0953 in biological context

• Flux balance analysis to identify metabolic roles

• Machine learning to identify patterns across diverse datasets

Chemical biology:

• Activity-based protein profiling to identify substrate classes

• Chemoproteomics to map interaction landscapes

• Photo-crosslinking to capture transient interactions

• Metabolite profiling combined with protein activity

Synthetic biology:

• Minimal systems reconstitution to test functional hypotheses

• Heterologous expression in diverse hosts to identify interacting partners

• Directed evolution to enhance detectable activities

• Design of reporter systems functional at high temperatures

Biophysics and biochemistry:

• High-throughput enzyme assay development

• Spectroscopic techniques adapted for extreme conditions

• Isothermal titration calorimetry for binding studies

• Surface plasmon resonance with temperature control

An integrated approach might involve initial computational predictions to guide experimental design, biophysical characterization to determine structural features, biochemical assays to test functional hypotheses, and systems biology to place findings in biological context. Collaboration across these disciplines, with experts in extremophile biology, would create a comprehensive workflow for efficiently characterizing this uncharacterized protein.