Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0971 (MJ0971)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ0971; Uncharacterized protein MJ0971
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0971
Target Protein Sequence
MNMDTSKVILIVAIIIWIILYSIRDSINLKTYGGIFGILRTKLGLKTIEKLGKYKIWQKI GIISIPICVILGFFMLLNIIDMSIRLLSGTLPKEAAKPVVFLFGDVIPWIPGIIALLIAI SVHELAHGIFAKSFGIKVKSSGILLLLGLPLGAFVELGDEFKTADKKIRGAIASAGPLAN LIIFLTSIPLLSFSYTLPTELKIIDVKEPASEFLQKGDIIYEINGKKINSLEDFKEFAKT IEPKKEYEIKILRDNKILTYKIVSSNEGKLGIMVSPTKNTALFINTIYWTYWFNFLLALF NLLPAMPLDGFHVWNAFPELLKERKNRFISKVGQILELFINEKTLGSITLLVWWVILGSI LYSMW
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0971

STRING: 243232.MJ_0971

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression and purification methodologies are recommended for MJ0971?

The standard expression system for MJ0971 is E. coli, which has been optimized to produce the full-length protein with an N-terminal His-tag. For purification, immobilized metal affinity chromatography (IMAC) is the primary methodology, taking advantage of the His-tag. The protein is typically supplied as a lyophilized powder, which requires careful reconstitution .

For reconstitution, the following protocol is recommended:

  • Briefly centrifuge the vial containing lyophilized protein to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

  • Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles

When designing expression experiments, researchers should consider the unique properties of archaeal proteins, which may require specialized buffers and conditions to maintain stability and function post-purification.

What storage and stability considerations are important for MJ0971?

Maintaining the stability of MJ0971 is crucial for experimental reproducibility. The reconstituted protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . This buffer composition helps maintain protein stability during storage. For long-term storage, the addition of glycerol to a final concentration of 50% is recommended before aliquoting and storing at -20°C/-80°C .

Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided. For ongoing experiments, working aliquots can be stored at 4°C for up to one week . Researchers should conduct stability tests when developing new experimental protocols, as buffer conditions may need optimization depending on the specific application.

Storage ConditionRecommendationDuration
Long-term storage-20°C/-80°C with 50% glycerolMonths
Working aliquots4°CUp to one week
Buffer compositionTris/PBS with 6% trehalose, pH 8.0N/A

What approaches are recommended for determining the subcellular localization of MJ0971?

Determining the subcellular localization of MJ0971 requires integrated experimental approaches. Based on the amino acid sequence analysis, MJ0971 contains hydrophobic regions that suggest potential membrane association. Several complementary techniques should be employed:

  • Computational prediction tools: Begin with algorithms such as PSORT, TMHMM, and SignalP to predict transmembrane domains, signal peptides, and subcellular targeting signals.

  • Fluorescent protein tagging: Generate constructs with GFP or other fluorescent proteins fused to MJ0971 for expression in archaeal model systems or heterologous systems.

  • Subcellular fractionation: Separate cellular components through differential centrifugation and detect MJ0971 using antibodies against the His-tag or the protein itself.

  • Immunoelectron microscopy: For high-resolution localization, use gold-labeled antibodies to visualize MJ0971 at the ultrastructural level.

When interpreting results, researchers should consider the potential differences between heterologous expression systems and the native archaeal environment. The sequence shows characteristics of membrane proteins, with multiple hydrophobic segments that could function as transmembrane domains . This structural feature should guide experimental design and interpretation of localization data.

What methodological approaches should be used to investigate protein-protein interactions of MJ0971?

For an uncharacterized protein like MJ0971, determining protein-protein interactions can provide valuable insights into function. A multi-faceted approach is recommended:

  • Pull-down assays: Utilize the His-tag of recombinant MJ0971 to pull down interacting partners from Methanocaldococcus jannaschii lysates or reconstituted systems.

  • Yeast two-hybrid screening: Though challenging for membrane-associated proteins, modified Y2H systems can be employed with appropriate controls.

  • Co-immunoprecipitation: Develop antibodies against MJ0971 or use anti-His antibodies to co-precipitate interacting proteins from native or reconstituted systems.

  • Cross-linking mass spectrometry: Use chemical cross-linkers to stabilize transient interactions followed by mass spectrometric identification of crosslinked peptides.

  • Surface plasmon resonance: For candidate interactors, quantify binding kinetics using purified components.

When designing these experiments, consider the extremophilic nature of M. jannaschii. Interactions may be temperature-dependent and buffer conditions should mimic the hyperthermophilic environment. Additionally, the hydrophobic nature of MJ0971 suggests potential membrane association, requiring detergent solubilization or membrane-mimetic systems for meaningful interaction studies .

How should researchers approach functional assays for an uncharacterized protein like MJ0971?

Developing functional assays for an uncharacterized protein requires a systematic approach that integrates bioinformatic predictions with experimental validation:

  • Sequence-based predictions: Start with comparative sequence analysis using tools like BLAST, Pfam, and InterPro to identify distant homologs with known functions or conserved domains.

  • Structural predictions: Employ modern protein structure prediction methods like AlphaFold to generate structural models that may suggest functional sites.

  • Genetic approaches: When possible, create knockout or knockdown strains in model archaea to assess phenotypic changes.

  • Activity screening: Develop a panel of biochemical assays based on predicted functions, including:

    • Enzyme activity assays (hydrolase, transferase activities)

    • Membrane transport assays

    • DNA/RNA binding assays

    • Lipid interaction assays

  • Metabolomic profiling: Compare metabolite profiles between wild-type and MJ0971-deficient strains to identify pathways affected.

The hydrophobic nature of MJ0971 suggests potential roles in membrane processes, such as transport or signaling . When designing functional assays, consider the extreme conditions of M. jannaschii's native environment, including high temperature (optimal growth at 85°C) and anaerobic conditions. These parameters should be incorporated into experimental designs to maintain physiological relevance.

What strategies are recommended for determining the three-dimensional structure of MJ0971?

Determining the structure of MJ0971 presents unique challenges due to its likely membrane association. A comprehensive structural biology approach is recommended:

When designing structural studies, consider the extreme thermostability of proteins from M. jannaschii, which may facilitate crystallization at higher temperatures. The amino acid sequence suggests multiple transmembrane segments, indicating that detergent solubilization or membrane-mimetic systems will be critical for maintaining native structure .

How can researchers analyze the secondary structure elements of MJ0971?

Secondary structure analysis provides fundamental insights into protein architecture and can guide further structural investigations. For MJ0971, several complementary approaches should be employed:

When interpreting results, researchers should consider that membrane proteins often show higher α-helical content in membrane environments compared to aqueous solutions. The sequence of MJ0971 suggests multiple transmembrane helices, which should be reflected in secondary structure analyses .

What approaches should be used to analyze post-translational modifications of MJ0971?

While archaea generally have fewer post-translational modifications (PTMs) than eukaryotes, they do exhibit important modifications that can affect protein function. For MJ0971, a comprehensive PTM analysis should include:

  • Mass spectrometry-based approaches:

    • Bottom-up proteomics: Enzymatic digestion followed by LC-MS/MS

    • Top-down proteomics: Analysis of intact protein to preserve modification patterns

    • Targeted approaches for specific modifications (phosphorylation, methylation, acetylation)

  • Site-specific enrichment techniques:

    • Phosphopeptide enrichment (IMAC, titanium dioxide)

    • Antibody-based enrichment for specific modifications

  • Chemical labeling strategies:

    • Isobaric tagging for quantitative comparison

    • Chemical derivatization for specific modifications

  • Bioinformatic analysis:

    • Prediction of modification sites using archaeal-specific algorithms

    • Comparative analysis with homologous proteins

When studying PTMs in MJ0971, researchers should consider that recombinant expression in E. coli may not reproduce the native modification pattern present in M. jannaschii. Therefore, comparative analyses between recombinant and native protein (if available) are valuable. Additionally, since M. jannaschii is a hyperthermophile, unique modifications that contribute to protein thermostability may be present .

How should researchers approach identifying the biochemical function of MJ0971?

Uncharacterized proteins like MJ0971 require systematic approaches to elucidate their biochemical functions. A comprehensive strategy should include:

  • Phylogenetic profiling: Identify organisms containing MJ0971 homologs and correlate with metabolic capabilities or environmental niches.

  • Gene neighborhood analysis: Examine genomic context for functional associations, as genes in prokaryotic operons often have related functions.

  • Metabolite screening: Incubate purified MJ0971 with cellular extracts or metabolite libraries, followed by mass spectrometry to identify potential substrates or products.

  • Activity-based protein profiling: Use chemical probes designed to react with specific enzyme classes to identify catalytic capabilities.

  • Thermal shift assays: Screen for ligands or substrates that stabilize the protein structure, indicating specific binding.

  • Heterologous expression phenotyping: Express MJ0971 in model organisms and assess phenotypic changes that might suggest function.

When designing these experiments, consider the membrane-associated nature of MJ0971 as indicated by its amino acid sequence . Appropriate detergents or membrane mimetics may be necessary to maintain native conformation. Additionally, M. jannaschii's hyperthermophilic nature suggests that optimal activity may require elevated temperatures (80-85°C) and anaerobic conditions.

What methodological approaches are recommended for studying MJ0971's potential role in membrane processes?

The amino acid sequence of MJ0971 suggests transmembrane domains, indicating potential roles in membrane processes. Several specialized techniques should be employed:

  • Proteoliposome reconstitution assays:

    • Incorporate purified MJ0971 into liposomes of defined composition

    • Measure transport of ions, small molecules, or solutes across membranes

    • Assess membrane permeability changes in response to environmental conditions

  • Membrane association studies:

    • Differential extraction using increasing detergent concentrations

    • Membrane flotation assays to confirm integral membrane association

    • Proteolytic accessibility mapping to determine topology

  • Electrophysiology approaches:

    • Planar lipid bilayer recordings to detect channel or pore formation

    • Patch-clamp analysis of MJ0971-expressing cells or proteoliposomes

  • Fluorescence-based techniques:

    • FRET analysis to detect conformational changes in response to stimuli

    • Fluorescent substrate transport assays

    • Fluorescence recovery after photobleaching (FRAP) to assess lateral mobility

When interpreting results, consider that archaeal membrane lipids differ significantly from bacterial or eukaryotic membranes. While E. coli-expressed MJ0971 is accessible for study , its native environment contains archaeal-specific lipids with ether linkages rather than ester linkages. For physiologically relevant studies, archaeal lipid extracts or synthetic archaeal-like lipids should be considered for membrane reconstitution experiments.

How can researchers investigate the potential thermostability mechanisms of MJ0971?

As a protein from the hyperthermophilic archaeon M. jannaschii, MJ0971 is expected to display remarkable thermostability. Understanding these mechanisms has both fundamental and biotechnological significance. Recommended approaches include:

  • Thermal denaturation profiling:

    • Differential scanning calorimetry (DSC) to determine melting temperature (Tm)

    • Circular dichroism thermal melts to monitor secondary structure changes

    • Intrinsic fluorescence spectroscopy to detect tertiary structure unfolding

    • Comparison with mesophilic homologs when available

  • Structural basis of thermostability:

    • Analysis of amino acid composition (increased charged residues, decreased thermolabile residues)

    • Salt bridge and hydrogen bond network identification

    • Hydrophobic core packing assessment

    • Disulfide bond or metal-binding site identification

  • Mutagenesis studies:

    • Targeted mutations of residues predicted to contribute to thermostability

    • Domain swapping with mesophilic homologs

    • Rational design of stabilizing mutations

  • Molecular dynamics simulations:

    • Comparison of dynamics at mesophilic (37°C) versus hyperthermophilic (85°C) temperatures

    • Identification of flexible versus rigid regions

    • Water network and hydration shell analysis

When conducting thermostability studies, researchers should ensure that buffer components are stable at the high temperatures used. Additionally, experiments should include appropriate controls to distinguish protein unfolding from buffer effects or instrument limitations. The full-length MJ0971 protein has 365 amino acids , providing ample opportunity to study various thermostabilization mechanisms that may be distributed throughout the sequence.

How can researchers employ advanced imaging techniques to study MJ0971 in cellular contexts?

Advanced imaging approaches provide unique insights into protein localization, dynamics, and interactions within cellular environments. For MJ0971, consider these sophisticated imaging strategies:

  • Super-resolution microscopy techniques:

    • Stimulated emission depletion (STED) microscopy for membrane protein organization

    • Photoactivated localization microscopy (PALM) for single-molecule tracking

    • Stochastic optical reconstruction microscopy (STORM) for nanoscale distribution patterns

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence localization with ultrastructural context

    • Immunogold labeling with EM tomography for 3D visualization

    • Cryo-CLEM to preserve native state without fixation artifacts

  • Live-cell imaging approaches:

    • Fluorescence recovery after photobleaching (FRAP) for mobility assessment

    • Fluorescence correlation spectroscopy (FCS) for diffusion and concentration measurements

    • Single-particle tracking for dynamic behavior analysis

  • Proximity labeling combined with imaging:

    • APEX2-based proximity labeling for identifying neighboring proteins

    • BioID-based approaches for interaction networks in native environment

    • Visualization of labeled proximity partners

When designing imaging experiments, researchers must consider appropriate expression systems. While E. coli is used for recombinant production , archaeal model systems or carefully designed heterologous expression systems may be needed for physiologically relevant imaging. The membrane association of MJ0971 presents additional challenges, requiring specialized membrane-preserving sample preparation techniques.

What computational and systems biology approaches can advance understanding of MJ0971 function?

Integrating computational and experimental data through systems biology approaches can accelerate functional discovery for uncharacterized proteins like MJ0971:

  • Network-based function prediction:

    • Construct protein-protein interaction networks incorporating experimental data

    • Apply guilt-by-association algorithms to predict function from network neighbors

    • Use Bayesian integration of multiple data types (genomic context, expression, physical interactions)

  • Molecular dynamics simulations:

    • Simulate MJ0971 behavior in membrane environments

    • Identify potential ligand binding sites through cavity analysis

    • Model conformational changes in response to environmental conditions

  • Machine learning approaches:

    • Train ML models on known archaeal protein functions to predict MJ0971 function

    • Apply deep learning to predict protein-protein or protein-ligand interactions

    • Use transfer learning from related proteins with known functions

  • Multi-omics data integration:

    • Correlate transcriptomic, proteomic, and metabolomic data under various conditions

    • Apply constraint-based modeling to predict metabolic roles

    • Develop testable hypotheses based on integrated data analysis

When implementing computational approaches, researchers should account for the unique properties of archaeal proteins and the hyperthermophilic environment of M. jannaschii. Standard parameters developed for mesophilic proteins may require adjustment. The full amino acid sequence of MJ0971 provides the foundation for computational analyses, but results should be experimentally validated given the limitations of current prediction methods for uncharacterized archaeal proteins.

What cutting-edge structural biology techniques are emerging for challenging membrane proteins like MJ0971?

Traditional structural biology approaches face limitations with membrane proteins like MJ0971. Several cutting-edge technologies are emerging that researchers should consider:

  • Cryo-electron tomography with subtomogram averaging:

    • Visualize proteins in native membrane environments

    • Capture different conformational states

    • Achieve medium-resolution structural information in situ

  • Integrative modeling with sparse and hybrid data:

    • Combine low-resolution experimental data with computational prediction

    • Integrate distance constraints from crosslinking, EPR, and FRET

    • Use co-evolution analysis to predict contact maps

  • Microcrystal electron diffraction (MicroED):

    • Determine structures from nanocrystals too small for traditional X-ray crystallography

    • Advantage for membrane proteins that often form small crystals

    • Lower radiation damage compared to conventional electron microscopy

  • Serial femtosecond crystallography at X-ray free electron lasers (XFELs):

    • Outrun radiation damage using ultrashort X-ray pulses

    • Collect data from microcrystals in lipidic environments

    • Capture time-resolved structural changes

  • AlphaFold and other AI structure prediction approaches:

    • Apply deep learning methods specifically trained on membrane proteins

    • Combine with sparse experimental data for refinement

    • Generate testable structural hypotheses

When applying these advanced techniques to MJ0971, researchers should consider the unique challenges posed by archaeal membrane proteins. The high hydrophobicity suggested by the amino acid sequence indicates multiple membrane-spanning regions that will require specialized approaches for structural determination. Additionally, the thermostability of M. jannaschii proteins may provide advantages for some techniques while presenting challenges for others.

What strategies can address protein aggregation issues when working with recombinant MJ0971?

Protein aggregation is a common challenge when working with recombinant membrane proteins like MJ0971. Several methodological approaches can minimize this issue:

  • Optimization of expression conditions:

    • Lower induction temperature (16-20°C) to slow folding and reduce inclusion body formation

    • Reduce inducer concentration to decrease expression rate

    • Co-express with molecular chaperones specific for membrane proteins

    • Consider specialized E. coli strains designed for membrane protein expression

  • Solubilization and purification optimization:

    • Systematic detergent screening (mild non-ionic to zwitterionic detergents)

    • Detergent concentration optimization to prevent aggregation

    • Addition of lipids during solubilization to stabilize native conformation

    • Use of amphipathic polymers (amphipols) or nanodiscs as alternatives to detergents

  • Buffer optimization strategies:

    • Screen various pH conditions (typically pH 7.0-8.5 for archaeal proteins)

    • Evaluate salt concentration effects (150-500 mM)

    • Test stabilizing additives (glycerol, trehalose, specific lipids)

    • Consider archaeal-specific buffer components

  • Analytical approaches to monitor aggregation:

    • Dynamic light scattering to detect early aggregation

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation to characterize oligomeric states

The recombinant MJ0971 is typically supplied as a lyophilized powder and should be reconstituted following specific guidelines to minimize aggregation . Adding glycerol to a final concentration of 50% helps maintain stability during storage . When developing new protocols, researchers should conduct pilot experiments to optimize conditions specific to their experimental setup.

How can researchers overcome challenges in functional assays for uncharacterized proteins?

Developing functional assays for uncharacterized proteins like MJ0971 presents significant challenges. Consider these methodological approaches to overcome common obstacles:

  • Addressing the absence of positive controls:

    • Develop activity-independent binding assays as initial screens

    • Use phylogenetically related proteins with known functions as approximate controls

    • Employ activity-based protein profiling with broad-spectrum probes

    • Design assays with internal validation steps

  • Managing technical limitations:

    • Establish signal-to-noise thresholds through multiple negative controls

    • Implement orthogonal assay formats to confirm initial findings

    • Vary protein concentration to establish dose-dependency

    • Consider high-throughput screening followed by detailed validation

  • Overcoming environmental constraints:

    • Design assays compatible with high temperature (80-85°C) for M. jannaschii proteins

    • Establish anaerobic conditions when necessary

    • Account for archaeal-specific cofactors or metal requirements

    • Develop specialized equipment adaptations for extremophilic conditions

  • Validation strategies:

    • Confirm activity with multiple batches of purified protein

    • Use site-directed mutagenesis of predicted catalytic residues

    • Correlate in vitro findings with in vivo phenotypes when possible

    • Apply isothermal titration calorimetry to quantify binding parameters

When developing functional assays for MJ0971, researchers should consider its likely membrane association and design assays compatible with detergent-solubilized or membrane-reconstituted protein. The uncharacterized nature of MJ0971 suggests that initial screens should be broad, encompassing various potential functions such as transport, signaling, or enzymatic activity.

What approaches can address reproducibility challenges in MJ0971 research?

Ensuring reproducibility in research with uncharacterized proteins like MJ0971 requires systematic approaches to minimize variability:

  • Protein quality control measures:

    • Implement batch-to-batch consistency checks through SDS-PAGE and western blotting

    • Verify protein folding through circular dichroism or fluorescence spectroscopy

    • Establish activity benchmarks for functional consistency

    • Document detailed protein handling protocols including freeze-thaw cycles

  • Standardized experimental protocols:

    • Develop detailed standard operating procedures (SOPs) for key techniques

    • Specify critical parameters including buffer composition, temperature, and incubation times

    • Implement internal controls to normalize between experiments

    • Use automated systems where possible to reduce operator variability

  • Data management and analysis standardization:

    • Establish pre-defined analysis pipelines before data collection

    • Use blinded analysis when appropriate

    • Implement statistical power calculations to determine appropriate sample sizes

    • Document all data transformations and exclusion criteria

  • Reporting standards:

    • Provide complete methodological details including reconstitution methods

    • Report protein storage conditions and shelf-life validation

    • Include all negative and failed experiments in laboratory records

    • Share raw data through appropriate repositories

For MJ0971 specifically, researchers should note that the recommended storage buffer contains Tris/PBS with 6% trehalose at pH 8.0 . Long-term storage requires glycerol addition to 50% and storage at -20°C/-80°C, while working aliquots can be kept at 4°C for up to one week . These specific handling requirements should be strictly adhered to and documented to ensure experimental reproducibility.

What are the most promising research directions for understanding MJ0971 function?

Based on current knowledge and technological capabilities, several research directions show particular promise for elucidating MJ0971 function:

  • Integrated structural and functional approaches offer the most comprehensive path forward. Combining cryo-EM or X-ray crystallography with functional assays can connect structure to biological role. The hydrophobic nature of MJ0971 suggests membrane association , making structural studies challenging but potentially revealing about its function in membrane processes.

  • Comparative genomics and evolutionary analyses can provide context by identifying conserved domains and co-evolution patterns. As genomic data from extremophiles expands, the functional context of MJ0971 may become clearer through phylogenetic profiling and gene neighborhood analysis.

  • Systems biology approaches that integrate transcriptomics, proteomics, and metabolomics data can place MJ0971 within broader cellular networks. Correlation analysis under various stress conditions may reveal functional associations even without direct biochemical characterization.

  • Genetic manipulation in model archaea, though technically challenging, offers powerful insights. While M. jannaschii itself lacks established genetic tools, related archaeal species with genetic systems could be used to study MJ0971 homologs.

Future research should leverage the growing toolkit for extremophile biology while addressing the unique challenges posed by archaeal membrane proteins. The fundamental question of why this protein has been conserved in Methanocaldococcus jannaschii remains central to understanding its biological significance.

How might insights from MJ0971 contribute to broader understanding of archaeal biology?

Research on uncharacterized proteins like MJ0971 has implications beyond the specific protein, potentially enhancing our understanding of archaeal biology in several ways:

  • Archaeal membrane biology remains less understood than bacterial or eukaryotic counterparts. As a probable membrane protein , MJ0971 characterization could reveal archaeal-specific adaptations for membrane function under extreme conditions. These insights might clarify how archaeal membrane proteins maintain functionality at temperatures where conventional membranes would lose integrity.

  • Evolutionary adaptations to extreme environments are encoded in archaeal proteins. Uncovering the structure-function relationships in MJ0971 may reveal molecular mechanisms of thermostability that extend our understanding of protein adaptation to extreme conditions. These principles could inform both fundamental evolutionary biology and biotechnological applications.

  • Archaeal-specific cellular processes may be discovered through functional characterization. Many archaeal proteins participate in unique metabolic or regulatory pathways without bacterial or eukaryotic counterparts. Determining MJ0971's role could reveal novel pathways or mechanisms specific to archaea.

  • Methodological advances developed to study challenging proteins like MJ0971 will benefit the broader field of archaeal biology. Techniques optimized for expression, purification, and functional analysis of archaeal membrane proteins will expand the toolkit available for studying this domain of life.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.