Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0976 (MJ0976)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ0976; Uncharacterized protein MJ0976
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-366
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0976
Target Protein Sequence
MSEDSNPKNDLKLKMYETFRSHIERAENSFWTYMLFYLQFLVGINGAVGILCRYLSNNLQ
NFPTEIIIAFLALVNILLSLIGIIVIIERGKWFFRNMILTVNLERYILKEEHIKIIPKRY
SKFDNFNKVIDTTGRIFISIFIGIYMISVIALGYLANSCKTIILFGTGFFIIVVIIYFLD
LLDWIYRRIDSNEYRKVIGVVLFISFIPPLMNYFIYDIINLICSYIPESFIVAMIVILIF
VIIDVYYNAKKHIENTIIMLSLERTVNDIDDIIKILKNIRLDDTKKEELKKKLRKIKKLI
ENVIKLLGGTSENGTQNNNLEEAKSKITEACRKISGNNIFEAINELNEAKYIINNKINEL
TQSDSS
Uniprot No.
Target Background
Database Links
KEGG: mja:MJ_0976
STRING: 243232.MJ_0976
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
