Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0998 (MJ0998)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is produced in E. coli with optimized protocols for archaeal thermostability:

ParameterDetails
Expression SystemEscherichia coli BL21(DE3)
TagN-terminal 6xHis tag
Purification MethodImmobilized Metal Affinity Chromatography (IMAC)
Purity>90% (SDS-PAGE verified)
Yield2-5 mg/L culture (lyophilized form)
Storage-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0); avoid freeze-thaw cycles

Biochemical Properties

Key stability metrics from quality control assays:

TestResult
Thermal StabilityRetains solubility at 85°C (matching native M. jannaschii habitat)
SolubilityRequires 0.1-1.0 mg/mL in deionized water + 50% glycerol
AggregationMinimal (<5% particulate matter after centrifugation)

Research Applications

Though functionally uncharacterized, MJ0998 is utilized in:

  • Comparative Proteomics: Studying archaeal vs. bacterial membrane protein folding

  • Extremophile Adaptations: Analyzing thermal stability mechanisms through mutagenesis

  • Methanogenesis Pathways: Investigating potential roles in hydrogenase complexes

  • Immunoassays: Commercial ELISA kits for antibody validation (e.g., Anagnostics Cat# CSB-CF691220MRU)

Current Research Challenges

  • Functional Annotation: No experimental data links MJ0998 to specific enzymatic activities or metabolic pathways

  • Interaction Networks: Yeast two-hybrid screens show no confirmed binding partners to date

  • Structural Studies: X-ray crystallography hindered by membrane association tendencies

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ0998; Uncharacterized protein MJ0998
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0998
Target Protein Sequence
MKSLYALIFLLFVIVVSYIFNGLWSVFNIKHVFWVNLFLLIAFHPQHLDGLIILLLIPLK IFSNFKLKLQCIIALVGILLTIIKGVIKSGFGWILRILFFFVRMMTVSFINLVVFSILLT SVYVLGYVAFLKPDDIQFGTLYTAFGGLALLGAGIKIIQHFIKQSEEIAQEEFKKWYETE VKNFMYSLFITAKNAFPKFLDDLLAKGVVSQEEYQNLIKLYSHILARILKNDEEKMKIPT F
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0998

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii Uncharacterized Protein MJ0998?

MJ0998 is a full-length protein (241 amino acids) from the archaeal organism Methanocaldococcus jannaschii. It is classified as an uncharacterized protein, meaning its precise biological function remains to be fully elucidated. The protein is identified in the UniProt database under the accession number Q58404 and can be recombinantly expressed with various tags for research purposes . As part of the M. jannaschii genome, MJ0998 represents one of the open reading frames (ORFs) that has been sequenced but whose function is still being investigated through various biochemical and bioinformatic approaches .

How are recombinant forms of MJ0998 typically expressed?

Recombinant MJ0998 is commonly expressed using Escherichia coli as the host organism. The full-length coding sequence (spanning amino acids 1-241) is typically cloned into expression vectors that allow for the addition of purification tags, such as N-terminal histidine (His) tags . The expression conditions must be optimized to account for the challenges of expressing archaeal proteins in bacterial systems, including potential differences in codon usage and protein folding environments. The recombinant protein can then be purified using affinity chromatography approaches that exploit the added tags, followed by additional purification steps if higher purity is required for specific applications .

What are the recommended storage and handling conditions for recombinant MJ0998?

For optimal stability and activity retention, recombinant MJ0998 should be stored according to the following guidelines:

  • Long-term storage: Store at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles

  • Storage buffer composition: Tris/PBS-based buffer containing 6% trehalose at pH 8.0

  • For glycerol stocks: Add glycerol to a final concentration of 50%

  • Working aliquots: Can be stored at 4°C for up to one week

  • Reconstitution: Prior to opening, briefly centrifuge the vial to bring contents to the bottom

  • Concentration: Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. For experiments requiring multiple uses, creating smaller working aliquots is strongly recommended .

What experimental approaches can be used to characterize the function of MJ0998?

Since MJ0998 is an uncharacterized protein, multiple complementary approaches should be employed to elucidate its function:

  • Structural Analysis: X-ray crystallography or NMR spectroscopy can provide insights into protein folding and potential active sites. Similar approaches have been successfully used for other M. jannaschii proteins such as MJ1099, which was solved to 1.7 Å resolution using anomalous scattering methods .

  • Bioinformatic Analysis: Sequence comparison with homologous proteins, domain identification, and secondary structure prediction. This approach can identify conserved motifs that might indicate function .

  • Biochemical Assays: Testing for enzymatic activities based on predicted functions from bioinformatic analyses.

  • Protein-Protein Interaction Studies: Pull-down assays, yeast two-hybrid, or co-immunoprecipitation to identify binding partners.

  • Gene Knockout/Complementation: If possible, creating mutants in M. jannaschii or related organisms to observe phenotypic changes.

The combined results from these approaches can provide converging evidence for the functional role of MJ0998 in M. jannaschii metabolism or cellular processes .

How can I design optimal PCR primers for amplifying the MJ0998 gene?

Designing effective primers for MJ0998 amplification requires consideration of several key factors:

  • Sequence Specificity: Using the nucleotide sequence from the M. jannaschii genome (available in databases referenced in the genome sequencing project), design primers that specifically target the MJ0998 gene without cross-amplification of other regions .

  • Codon Optimization: When amplifying for heterologous expression, consider codon optimization for the target expression system (e.g., E. coli).

  • Addition of Restriction Sites: Include appropriate restriction enzyme sites for subsequent cloning into expression vectors. Ensure these sites are not present within the gene sequence.

  • Primer Properties:

    • Length: 18-30 nucleotides

    • GC content: 40-60%

    • Melting temperature: ~60°C with <5°C difference between forward and reverse primers

    • Avoid secondary structures and primer-dimers

  • Verification: Use tools like BLAST to ensure primers are specific to MJ0998 and will not amplify unintended sequences .

The M. jannaschii genome sequence information provides the necessary foundation for designing these primers with high specificity .

What computational approaches can predict the structure and function of MJ0998?

Several computational methods can be employed to gain insights into the potential structure and function of MJ0998:

  • Homology Modeling: Using proteins with known structures as templates to predict MJ0998 structure. This approach works best when sequence identity is >30% with template proteins.

  • Ab initio Structure Prediction: For novel protein folds with no close homologs, methods like AlphaFold or Rosetta can predict structures based on physicochemical principles.

  • Functional Prediction Tools:

    • InterProScan for domain and motif identification

    • Gene Ontology (GO) term prediction

    • Protein-protein interaction network analysis

  • Molecular Dynamics Simulations: To study potential conformational changes and stability of the predicted structures.

  • Active Site Prediction: Tools like CASTp or SiteMap can identify potential binding pockets or catalytic sites.

Similar approaches have been successfully employed for other M. jannaschii proteins, such as MJ1099, where bioinformatic analyses identified a potential active site that is highly conserved among homologs .

How can sequence identity analysis be used to identify potential functions of MJ0998?

Sequence identity analysis is a powerful approach for inferring potential functions of uncharacterized proteins like MJ0998:

  • Threshold Determination: Functions can often be inferred when sequence identity is above certain thresholds:

    • 40%: High confidence in similar function

    • 25-40%: Possible similar function

    • <25%: Limited functional inference

  • Methodological Approach:

    • Perform BLAST searches against curated databases (UniProt, PDB)

    • Use position-specific scoring matrices (PSSMs) for sensitive detection of remote homologs

    • Apply multiple sequence alignment (MSA) to identify conserved residues

  • Identity Calculation:
    A protein with a nucleotide sequence at least 95% identical to MJ0998 would mean that up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total in the reference sequence may be inserted .

  • Tools and Software:
    Software like the Bestfit program (Wisconsin Sequence Analysis Package) can be used to determine if a nucleic acid molecule is at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the nucleotide sequence of MJ0998 .

What are the challenges in expressing archaeal proteins like MJ0998 in heterologous systems?

Expressing archaeal proteins in bacterial or eukaryotic systems presents several challenges that researchers must address:

  • Codon Usage Bias: Archaea often have different codon preferences compared to common expression hosts like E. coli. This can lead to:

    • Translational pausing

    • Premature termination

    • Low protein yields
      Solution: Codon optimization of the gene sequence for the host organism

  • Post-translational Modifications: Archaea-specific modifications might be absent in heterologous systems, potentially affecting:

    • Protein folding

    • Activity

    • Stability
      Solution: Consider using archaeal expression systems or adding missing modification enzymes

  • Protein Folding Environment: Archaeal proteins are often adapted to extreme conditions:

    • High temperature

    • High salt

    • Anaerobic environments
      Solution: Modify expression conditions or use chaperone co-expression

  • Membrane Proteins: For transmembrane proteins like MJ0998 (based on its sequence characteristics), additional challenges include:

    • Toxicity to host cells

    • Inclusion body formation

    • Improper membrane insertion
      Solution: Use specialized membrane protein expression systems or fusion tags

  • Solubility Issues: Many archaeal proteins form inclusion bodies in mesophilic hosts
    Solution: Expression at lower temperatures, fusion to solubility-enhancing tags, or refolding strategies

How can recombinant MJ0998 be used in structural biology studies?

Recombinant MJ0998 can be utilized in various structural biology approaches to elucidate its three-dimensional structure and potential functional mechanisms:

  • X-ray Crystallography:

    • Purify recombinant MJ0998 to >95% homogeneity using affinity chromatography followed by size exclusion chromatography

    • Screen various crystallization conditions (pH, salt, precipitants)

    • Collect diffraction data and solve the structure

    • This approach has been successful for other M. jannaschii proteins like MJ1099, which was solved to 1.7 Å resolution

  • NMR Spectroscopy:

    • Isotope-label the protein (15N, 13C) during expression

    • Collect multidimensional NMR spectra

    • Determine solution structure and dynamics

  • Cryo-Electron Microscopy:

    • Particularly useful if MJ0998 forms larger complexes

    • Can provide structural information without crystallization

  • Small-Angle X-ray Scattering (SAXS):

    • For low-resolution structural information in solution

    • Especially useful for flexible proteins or those difficult to crystallize

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • To probe dynamics and conformational changes

    • Can identify regions involved in ligand binding or protein-protein interactions

The structural information obtained can provide insights into the potential function of MJ0998 and guide further biochemical and functional studies .

What is known about the genomic context of MJ0998 and how might this inform functional studies?

The genomic context of MJ0998 within the M. jannaschii genome can provide valuable clues about its potential function:

  • Operon Structure: Genes located in the same operon often encode proteins involved in related pathways or complexes. Analysis of genes upstream and downstream of MJ0998 may reveal functional associations.

  • Comparative Genomics: Examining the conservation and arrangement of MJ0998 and its neighboring genes across related archaeal species can indicate functional importance and potential co-evolution of gene clusters.

  • Transcriptional Analysis: RNA-Seq data can reveal co-expression patterns with genes of known function, suggesting potential involvement in similar processes.

  • Regulatory Elements: Identifying promoters, enhancers, and other regulatory elements in the vicinity of MJ0998 can provide insights into its regulation and expression patterns.

  • Horizontal Gene Transfer: Analysis of GC content and codon usage can indicate whether MJ0998 was acquired through horizontal gene transfer, potentially suggesting adaptation to specific ecological niches.

The M. jannaschii genome has been fully sequenced, providing a complete framework for this contextual analysis that can guide targeted functional studies of MJ0998 .

How can studying MJ0998 contribute to our understanding of archaeal biology and evolution?

Investigating uncharacterized proteins like MJ0998 from archaeal species is valuable for several reasons:

  • Evolutionary Insights: Archaea represent a distinct domain of life, and understanding their unique proteins can provide insights into early evolutionary divergence and the development of cellular processes across all domains of life.

  • Novel Biochemical Mechanisms: Archaeal proteins often exhibit unique structural features and catalytic mechanisms adapted to extreme environments, potentially leading to the discovery of novel biochemical principles.

  • Methanogenesis Understanding: M. jannaschii is a methanogenic archaeon, and characterizing its proteins contributes to our understanding of methanogenesis, a process with significant implications for both climate science and biotechnology .

  • Extremophile Adaptations: As M. jannaschii is a hyperthermophile, studying its proteins like MJ0998 can reveal mechanisms of protein stability and function under extreme conditions.

  • Biotechnological Applications: Uncovering the function of MJ0998 could lead to applications in biotechnology, particularly if it possesses unique catalytic properties or stability features useful for industrial processes.

  • Therapeutic Potential: Understanding archaea-specific proteins could potentially lead to the development of targeted inhibitors for methanogenic archaea in the human digestive tract, which are sources of greenhouse gas methane .

What strategies can improve solubility of recombinant MJ0998 during expression and purification?

Improving the solubility of recombinant MJ0998 can be achieved through several strategies:

  • Expression Conditions Optimization:

    • Reduce expression temperature (16-20°C)

    • Use lower inducer concentrations

    • Test different media formulations

    • Adjust induction time and duration

  • Solubility-Enhancing Tags:

    • MBP (Maltose-Binding Protein)

    • SUMO

    • Thioredoxin

    • GST (Glutathione S-Transferase)

    • NusA
      These can be more effective than the standard His-tag for improving solubility

  • Co-expression with Chaperones:

    • GroEL/GroES

    • DnaK/DnaJ/GrpE

    • Trigger factor

  • Buffer Optimization:

    ComponentRange to TestEffect
    pH6.0-9.0Affects protein charge
    Salt100-500 mM NaClShields electrostatic interactions
    AdditivesGlycerol (5-10%)Stabilizes hydrophobic regions
    Detergents (0.05-0.1%)Mimics membrane environment
    Arginine (50-100 mM)Prevents aggregation
  • Refolding from Inclusion Bodies:

    • If soluble expression fails, purify inclusion bodies

    • Solubilize with strong denaturants (8M urea or 6M guanidine HCl)

    • Refold by gradual dialysis or dilution

  • Cell-Free Expression Systems:

    • Bypass cellular toxicity issues

    • Allow direct manipulation of the expression environment

How can researchers validate that recombinant MJ0998 maintains its native structure and function?

Validating the native structure and function of recombinant MJ0998 is crucial for meaningful experimental outcomes and requires multiple complementary approaches:

  • Structural Validation:

    • Circular Dichroism (CD): Compare secondary structure content with predictions

    • Thermal shift assays: Assess protein stability

    • Limited proteolysis: Identify properly folded domains resistant to digestion

    • Size exclusion chromatography: Confirm expected oligomeric state

  • Functional Validation:

    • Activity assays: Based on predicted function from bioinformatic analyses

    • Ligand binding studies: Using thermal shift, isothermal titration calorimetry, or surface plasmon resonance

    • Complementation studies: Test if recombinant protein can rescue function in knockout models

  • Comparative Analysis:

    • Express protein in multiple systems and compare properties

    • If possible, purify native protein from M. jannaschii for direct comparison

  • Spectroscopic Methods:

    • Fluorescence spectroscopy: Assess tertiary structure

    • NMR fingerprinting: Compare spectral features with predictions

  • Post-translational Modifications:

    • Mass spectrometry: Identify modifications present in native but potentially missing in recombinant protein

    • Assess impact of missing modifications on structure and function

What are the most promising approaches for determining the function of MJ0998?

Based on current knowledge and available techniques, several promising approaches could lead to functional characterization of MJ0998:

  • Integrated Structural-Functional Analysis: Combining high-resolution structural determination with computational prediction of functional sites, followed by site-directed mutagenesis to validate these predictions.

  • Comparative Genomics and Phylogenomics: Leveraging the increasing number of sequenced archaeal genomes to identify patterns of gene conservation, co-evolution, and genomic context that might indicate function.

  • Protein-Protein Interaction Networks: Using techniques like affinity purification-mass spectrometry to identify interaction partners, potentially placing MJ0998 within known cellular pathways.

  • Metabolomics Approaches: If MJ0998 is involved in metabolism, comparing metabolite profiles between wild-type and mutant strains could reveal specific pathways affected.

  • CRISPR-Based Functional Genomics: If applicable to M. jannaschii or model archaeal systems, CRISPR technology could enable precise genetic manipulation to study phenotypic effects of MJ0998 disruption.

  • Heterologous Expression Systems: Testing the effects of MJ0998 expression in well-characterized model organisms to observe phenotypic changes that might indicate function.

The combination of these approaches, rather than any single method, is most likely to yield definitive functional characterization of this uncharacterized protein .

How might characterization of MJ0998 impact broader research fields?

The successful characterization of MJ0998 could have significant implications for multiple research areas:

  • Archaeal Biology: Expanding our understanding of archaeal-specific cellular processes and potentially identifying novel biological mechanisms not present in bacteria or eukaryotes.

  • Evolutionary Biology: Providing insights into the evolution of protein functions across domains of life, potentially revealing ancient conserved mechanisms or domain-specific innovations.

  • Extremophile Adaptations: If MJ0998 contributes to M. jannaschii's adaptation to extreme environments, its characterization could reveal novel mechanisms of protein stability and function under extreme conditions.

  • Methanogenesis Research: Given that M. jannaschii is a methanogenic archaeon, MJ0998 might play a role in methane production or related metabolic pathways, with implications for climate science and biotechnology.

  • Drug Development: Understanding archaeal-specific proteins could potentially lead to the development of targeted inhibitors for methanogenic archaea in the human digestive tract, which are sources of greenhouse gas methane .

  • Protein Structure-Function Relationships: Adding to our fundamental understanding of how protein sequence determines structure and function, particularly for proteins from extremophilic organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.