Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1017 (MJ1017)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Methanocaldococcus jannaschii Uncharacterized Protein MJ1017 (MJ1017)

Methanocaldococcus jannaschii Uncharacterized Protein MJ1017 (MJ1017) is a protein derived from the archaeon Methanocaldococcus jannaschii . M. jannaschii is noted for its resilience in extreme environments, such as deep-sea volcanoes . MJ1017 is considered an uncharacterized protein, which means its specific function has not been definitively determined through experimentation .

Basic Information

CategoryDescription
Full NameRecombinant Full Length Methanocaldococcus jannaschii Uncharacterized Protein MJ1017(MJ1017) Protein, His-Tagged
SourceE. coli
SpeciesMethanocaldococcus jannaschii
TagHis
Protein LengthFull Length (1-203 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
UniProt IDQ58423
Gene NameMJ1017
SynonymsMJ1017; Uncharacterized protein MJ1017

Expression and Purification

Recombinant MJ1017 protein is produced in E. coli and is fused with an N-terminal His tag to facilitate purification . The purification process typically involves affinity chromatography using the His tag, followed by methods such as SDS-PAGE to ensure a purity level greater than 90% .

Potential Functions and Interactions

While MJ1017 is annotated as an uncharacterized protein, bioinformatics analyses suggest potential functions and interactions with other proteins . These predictions are based on sequence homology and genomic context but require experimental validation to confirm its true biological role .

Related Research

Research on Methanocaldococcus jannaschii has led to advances in genetic systems that allow for the creation of mutants for physiological studies, as well as the purification of proteins and protein complexes . Patent WO1998007830A2 describes the complete genome sequence of Methanococcus jannaschii . The study of proteins like MJ1017 can be enhanced through recombinant DNA technology .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
MJ1017; Uncharacterized protein MJ1017
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1017
Target Protein Sequence
MKVKVYRVGGITGIFLIFLILLLLIILAIVALPIFLILMAIFGGYILLKYKIKSFFRKVW YNIRKKKIKIEDTSTNGEVKINFAKRIEIEDGKIETNNINTLLDYLDENTKSFAYYLKNI GAEFRDDGIYFKGYKIYPIFKKSYPINEIISLRYPENIDAVVLGLKGEPYDPKFLYLIPK EFLKDRMSISELKRFEIGDMVLK
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1017

STRING: 243232.MJ_1017

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MJ1017 and why is it of interest to researchers?

MJ1017 is an uncharacterized protein from Methanocaldococcus jannaschii, a hyperthermophilic methanogenic archaeon that grows optimally at temperatures around 85°C. This protein is of particular interest because it belongs to one of the most phylogenetically deeply rooted methanogens, providing potential insights into early protein evolution and archaeal metabolism. The protein consists of 203 amino acids in its full-length form and can be expressed recombinantly with affinity tags to facilitate purification and functional studies . As part of ongoing efforts to fully characterize the M. jannaschii proteome, MJ1017 represents one of many proteins whose functions remain to be elucidated through experimental approaches, contributing to our understanding of archaeal biology and extremophile adaptations.

What is currently known about the biochemical properties of MJ1017?

The biochemical properties of MJ1017 remain largely uncharacterized. As a protein from a hyperthermophilic organism, it is expected to exhibit thermostability and potentially retain activity at elevated temperatures, similar to other M. jannaschii proteins. Recombinant expressions systems have successfully produced MJ1017 with His-tags using E. coli as a heterologous host . The protein can be purified using standard affinity chromatography methods designed for His-tagged proteins. Current knowledge gaps include its three-dimensional structure, specific enzymatic activities, substrate specificity, and cofactor requirements. Researchers working with this protein often employ comparative analyses with other characterized proteins from M. jannaschii to generate hypotheses about potential functions, which can then be tested experimentally.

What are the recommended expression systems for recombinant MJ1017 production?

For recombinant production of MJ1017, E. coli expression systems have been successfully employed to generate His-tagged versions of the full-length protein (1-203 amino acids) . When designing expression strategies, researchers should consider several key factors:

  • Expression vector selection: Vectors with T7 promoters (such as pET series) often yield good expression for archaeal proteins in E. coli.

  • Strain optimization: E. coli BL21(DE3) derivatives, particularly those designed for expression of proteins containing rare codons, may improve expression levels.

  • Induction conditions: Lower induction temperatures (16-25°C) after IPTG addition often improve solubility of archaeal proteins.

  • Tag placement: While N-terminal His-tags have been successful , C-terminal tags might be considered if N-terminal tags affect function.

For researchers requiring native protein conditions, homologous expression in M. jannaschii is now possible thanks to recently developed genetic systems that utilize mevinolin resistance markers and homologous recombination approaches, as demonstrated for other M. jannaschii proteins . This approach involves the creation of suicide plasmids containing the gene of interest fused to affinity tags, followed by transformation using techniques adapted for hyperthermophilic methanogens.

What are the challenges in determining the structure of MJ1017, and how can they be addressed?

Determining the structure of MJ1017 presents several challenges common to uncharacterized archaeal proteins:

  • Protein stability: Although proteins from thermophiles are generally stable, MJ1017 might require specific buffer conditions to maintain stability during purification and crystallization attempts.

  • Crystallization difficulties: Uncharacterized proteins often have unpredictable crystallization behavior. Researchers should employ sparse matrix screening approaches with varying precipitants, pH values, and temperatures.

  • Structural homology limitations: The lack of closely related structures may complicate molecular replacement approaches for X-ray crystallography.

To address these challenges, a multi-faceted approach is recommended:

  • Thermal shift assays: Use differential scanning fluorimetry to identify buffer conditions that maximize protein stability.

  • Limited proteolysis: Identify stable domains that might crystallize more readily than the full-length protein.

  • NMR spectroscopy: For structural determination if crystallization proves difficult, especially for specific domains.

  • Cryo-EM: Consider single-particle analysis if the protein forms larger complexes or can be engineered to do so.

  • Computational approaches: Employ AlphaFold2 or similar tools to generate structural predictions that can guide experimental design and interpretation.

How can researchers investigate potential metabolic roles of MJ1017 in M. jannaschii?

Investigating the metabolic role of MJ1017 requires a combinatorial approach leveraging bioinformatics predictions and experimental validation:

What techniques are most effective for identifying protein-protein interactions involving MJ1017?

Several complementary approaches can effectively identify protein-protein interactions for MJ1017:

  • Affinity purification coupled with mass spectrometry (AP-MS): Express MJ1017 with affinity tags in M. jannaschii using the genetic system described for FprA . After gentle lysis under native conditions, capture MJ1017 and its interacting partners using affinity chromatography, followed by mass spectrometric identification of co-purified proteins.

  • Bacterial two-hybrid systems: Although traditional yeast two-hybrid systems may not be optimal for archaeal proteins due to different cellular environments, bacterial two-hybrid systems adapted for thermophilic proteins can be employed.

  • Cross-linking coupled with mass spectrometry (XL-MS): Use chemical cross-linkers with varying spacer lengths to capture transient interactions in vivo, followed by purification and mass spectrometric analysis.

  • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI): Test direct interactions between purified MJ1017 and candidate partner proteins identified through other methods or predicted through bioinformatic analyses.

  • Co-expression analysis: Analyze transcriptomic data from M. jannaschii to identify genes with expression patterns correlated with MJ1017, suggesting potential functional relationships or physical interactions.

When designing interaction studies, it's crucial to consider the extreme growth conditions of M. jannaschii and ensure that experimental conditions preserve native interactions that may be thermophilic-specific.

How should researchers optimize purification protocols for recombinant MJ1017?

Optimizing purification of recombinant MJ1017 requires addressing the unique properties of this archaeal protein:

  • Buffer optimization:

    • Start with buffers containing 50 mM Tris-HCl or HEPES (pH 7.5-8.0)

    • Include 300-500 mM NaCl to maintain solubility

    • Add 5-10% glycerol as a stabilizing agent

    • Consider including reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to prevent oxidation of cysteine residues

  • Affinity chromatography:

    • For His-tagged MJ1017, use Ni-NTA or TALON resins

    • Implement a two-step imidazole gradient (low concentration wash followed by elution) to improve purity

    • Maintain temperatures above 4°C during purification to prevent potential cold-denaturation

  • Secondary purification:

    • Size exclusion chromatography to separate monomeric protein from aggregates or contaminants

    • Ion exchange chromatography as an orthogonal purification step

  • Quality control metrics:

    • Verify purity by SDS-PAGE and Western blotting

    • Confirm identity by mass spectrometry, similar to the approach used for FprA purification

    • Assess homogeneity by dynamic light scattering or analytical size exclusion

  • Stability assessment:

    • Test thermal stability through differential scanning fluorimetry

    • Evaluate long-term storage conditions (e.g., flash-freezing in liquid nitrogen vs. storage at 4°C)

The yield of properly folded MJ1017 may be improved by heat treatment of lysates (60-70°C) prior to purification, as this can precipitate many E. coli proteins while leaving the thermostable archaeal protein in solution.

What are the most reliable approaches for assessing the enzymatic activity of an uncharacterized protein like MJ1017?

For uncharacterized proteins like MJ1017, a systematic multi-tiered approach to activity assessment is recommended:

  • Bioinformatic prediction of potential activities:

    • Analyze MJ1017 for conserved domains and motifs

    • Compare to the 266 enzymatic functions (EC numbers) identified in M. jannaschii through metabolic reconstruction

    • Look for structural similarities to known enzymes

  • Broad-spectrum activity screening:

    • Test general enzyme classes (hydrolase, oxidoreductase, transferase, etc.)

    • Screen against metabolite libraries or substrate panels

    • Employ colorimetric or fluorometric detection methods

  • Targeted hypothesis testing:

    • Focus on pathway gaps identified in M. jannaschii's metabolic reconstruction

    • Test activities in pathways where M. jannaschii is known to differ from other archaea

    • Investigate activities that would connect metabolically adjacent characterized enzymes

  • Cofactor screening:

    • Test archaeal-specific cofactors such as coenzyme F420, which is critical for many M. jannaschii enzymes such as FprA

    • Screen metal ions (Fe²⁺, Zn²⁺, Mg²⁺, Mn²⁺) that might be required for activity

    • Examine requirements for common cofactors (NAD⁺/NADH, NADP⁺/NADPH, ATP, etc.)

  • Specialized detection methods:

    • Couple potential enzymatic reactions to detectable secondary reactions

    • Use LC-MS to detect product formation from predicted substrates

    • Consider differential scanning fluorimetry to detect substrate binding through thermal shift

When designing activity assays, it's important to account for the hyperthermophilic nature of M. jannaschii by conducting reactions at elevated temperatures (60-85°C) and using thermostable assay components whenever possible.

How does MJ1017 potentially fit into the metabolic network of M. jannaschii?

While the specific function of MJ1017 remains uncharacterized, we can analyze its potential role in M. jannaschii's metabolic network based on comprehensive metabolic reconstructions:

  • Pathway gap analysis: The MJCyc metabolic reconstruction identified 113 metabolic pathways and 17 super-pathways in M. jannaschii . Examining pathway gaps in this reconstruction may provide clues to MJ1017's function, particularly in pathways where enzymatic activities have been biochemically demonstrated but specific genes have not been assigned.

  • Unusual metabolic features: M. jannaschii possesses several distinctive metabolic pathways that differ from bacteria and eukaryotes, including:

    • Modified mevalonate pathway for isoprenoid biosynthesis

    • Unique cobalamin biosynthesis pathways

    • Specialized sulfur metabolism pathways including sulfate assimilation

    • Methionine biosynthesis from homocysteine (EC 2.1.1.14; MJ1473)

  • Evolution of enzymatic functions: The case of shikimate kinase (MJ1440) illustrates how M. jannaschii enzymes can have no sequence similarity to bacterial or eukaryotic counterparts yet perform identical functions . MJ1017 might similarly represent a case of convergent evolution at the molecular level.

  • Missing pathways: Some pathways appear absent in M. jannaschii, such as complete cysteine biosynthesis . MJ1017 might be involved in alternative routes for synthesizing metabolites that are typically produced through these missing pathways.

Researchers should consider these metabolic context factors when designing experiments to elucidate MJ1017's function, as its role may be more evident when examining how it connects to established metabolic modules rather than when studied in isolation.

What can comparative genomics tell us about the evolutionary significance of MJ1017?

Comparative genomics approaches provide valuable insights into MJ1017's evolutionary context:

  • Phylogenetic distribution: Analyzing the presence or absence of MJ1017 homologs across archaeal lineages can reveal whether this protein is:

    • Widely conserved across archaea (suggesting fundamental importance)

    • Restricted to methanogens (indicating methanogenesis-specific roles)

    • Limited to thermophiles (suggesting thermal adaptation functions)

    • Specific to Methanocaldococcus (potentially indicating genus-specific adaptations)

  • Sequence conservation patterns: Examination of conserved residues across homologs can identify:

    • Potential active site residues (highly conserved across distant relatives)

    • Substrate binding regions (moderately conserved with specific variations)

    • Structural elements (conservation patterns following secondary structure)

  • Gene neighborhood conservation: Like the analysis that helped identify MJ1440 as a shikimate kinase , examining genes consistently co-located with MJ1017 across genomes may reveal functional associations.

  • Horizontal gene transfer analysis: Determining whether MJ1017 shows signatures of horizontal gene transfer or vertical inheritance can provide insights into its evolutionary history and potential functional adaptations.

  • Domain architecture analysis: Comparing domain organizations of MJ1017 homologs across species may reveal functional diversification through domain shuffling or fusion events.

Given M. jannaschii's position as a deeply rooted hyperthermophilic methanarchaeon , MJ1017's evolutionary patterns could provide unique insights into early archaeal metabolism and adaptations to extreme environments, particularly if it represents an ancient protein family that evolved before the divergence of major archaeal lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.