Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1024 (MJ1024)

Shipped with Ice Packs
In Stock

Description

Protein Overview

MJ1024 (UniProt ID: Q58430) is encoded by the mj1024 gene in M. jannaschii, a deep-sea methanogen first sequenced in 1996 . The recombinant protein spans 403 amino acids (43.7 kDa predicted molecular weight) and retains its full-length sequence .

Production and Purification

Recombinant MJ1024 is synthesized in Escherichia coli with an N-terminal His tag for affinity purification .

Key Parameters

ParameterDetails
Expression SystemE. coli
Purity≥90% (SDS-PAGE) ; ≥85% in commercial variants
FormLyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for stability

Research Applications

Though functionally uncharacterized, recombinant MJ1024 is utilized in:

  • Hypothesis-Driven Studies: Investigating its role in methanogenesis or stress adaptation, given M. jannaschii’s extremophilic nature .

  • Structural Biology: Potential crystallization or cryo-EM studies to resolve 3D architecture .

  • Metabolic Pathway Analysis: Integration into databases like MjCyc, which maps M. jannaschii’s metabolic networks .

Research Challenges and Opportunities

  • Functional Annotation: MJ1024 belongs to the 33% of M. jannaschii genes lacking functional assignments . Homology to transmembrane proteins suggests roles in transport or signaling.

  • Thermostability: Native thermophilic properties (optimal growth at 85°C) make MJ1024 a candidate for industrial enzyme engineering.

  • Genetic Tools: Recent advances in M. jannaschii genetic systems enable in vivo studies to validate recombinant protein behavior.

Future Directions

  • Enzymatic Assays: Testing for oxidoreductase or hydrolase activity, informed by related archaeal proteins like FprA homologs .

  • Interactome Mapping: Identifying binding partners via affinity purification-mass spectrometry.

  • Comparative Genomics: Leveraging databases like UniProt and MjCyc to infer evolutionary conservation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ1024; Uncharacterized protein MJ1024
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-403
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1024
Target Protein Sequence
MNSGDIMKLNIKKILTIGKREVLSNIKRKQFLIATIIGPLIIIALAIIGSFMMFDIKEIK VGYVDEFGLGIPNKVVENNFGKNTTIYFIKYENIEKGKEDVLNKSIDALIVIPKDYLDSG KIILYSTTKSPNPIITDTLNKFLLKKLLKGKVDNKTYNRVINPMNLEIYSVSKKGFEKET FLSQLLPIGFVFLLYMAISSLSGIIVSSIIEEKQNRIMELLLCYSSAENLMFGKILGISA VGLLQIGIWVLFALPIIITYAVKVSLYLAIFALIYFVLGYLFYSSLLCGLSSLFSHPKDA SQLISPIIIIQIIPIMFMNTIMVNPNHYMAKILSYVPFTAPYAVVLRASVTQLPLIEIVL STAIMIVSIVISFILSIKLFKIGVLLYEENLTLKRVIKIIFKK
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1024

STRING: 243232.MJ_1024

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What structural information is available for MJ1024?

While no experimental structure has been determined for MJ1024 through traditional methods like X-ray crystallography or NMR, a computational structure model has been generated using AlphaFold. This model (AF-Q58430-F1) was released in the AlphaFold Database on July 1, 2021, and last modified on September 30, 2022 .

How is recombinant MJ1024 protein typically produced?

Recombinant MJ1024 is typically produced using E. coli as an expression host. The full-length protein (residues 1-403) is expressed with an N-terminal His-tag to facilitate purification . The expression system uses a prokaryotic host (E. coli) rather than the native archaeal organism, which allows for higher yield and easier manipulation of growth conditions.

The general methodology involves:

  • Cloning the MJ1024 gene into an appropriate expression vector containing a His-tag coding sequence

  • Transforming the construct into an E. coli expression strain

  • Inducing protein expression under optimized conditions

  • Cell lysis and protein extraction

  • Purification using immobilized metal affinity chromatography (IMAC) to isolate the His-tagged protein

  • Further purification steps if higher purity is required

  • Lyophilization for storage and stability

The final product is a lyophilized powder with purity greater than 90% as determined by SDS-PAGE analysis .

What are the recommended storage and handling conditions for recombinant MJ1024?

For optimal stability and activity of recombinant MJ1024 protein, the following storage and handling recommendations should be followed:

  • Storage Temperature: Store at -20°C or -80°C upon receipt

  • Storage Form: The protein is provided as a lyophilized powder

  • Reconstitution:

    • Centrifuge the vial briefly before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage (50% is recommended)

  • Buffer Composition: The protein is supplied in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Aliquoting: Divide into working aliquots to avoid repeated freeze-thaw cycles

  • Working Stock: For short-term use, working aliquots can be stored at 4°C for up to one week

  • Freeze-Thaw Cycles: Repeated freezing and thawing is not recommended as it may affect protein stability and activity

How reliable are computational models of MJ1024?

  • Regional Confidence Variation: While the global score is high, the confidence score varies across different regions of the protein. Some regions may have very high confidence (pLDDT > 90) while others may have lower confidence (pLDDT ≤ 70) .

  • Validation Requirement: The model has no experimental data to verify its accuracy. As explicitly stated in the model metadata: "There are no experimental data to verify the accuracy of this computed structure model" .

  • Potential Unstructured Regions: Regions with pLDDT scores below 50 may be unstructured in isolation, which could affect functional interpretations .

What can be inferred about MJ1024 function based on sequence analysis?

While MJ1024 remains uncharacterized, several approaches can be used to infer potential functions based on sequence analysis:

  • Transmembrane Region Prediction: The amino acid sequence shows multiple hydrophobic stretches characteristic of membrane proteins, suggesting MJ1024 may be a membrane-associated protein. The sequence contains segments like "FLIATIIGPLIIIALAIIG" and "FVFLLYMAISSLSGIIVSSIIEEK" that show patterns typical of transmembrane domains .

  • Conserved Domain Analysis: Although not explicitly mentioned in the search results, researchers should examine the protein for conserved domains using tools like NCBI's Conserved Domain Database, InterPro, or Pfam.

  • Sequence Homology: Comparison with characterized proteins from other thermophilic archaea may reveal functional similarities. The related search result about nucleoside kinase from M. jannaschii (MjNK) suggests examining whether MJ1024 shares any structural features with the ribokinase family .

  • Structural Homology: The AlphaFold model can be used with tools like DALI or VAST to identify structural homologs that might share functional properties despite low sequence similarity .

  • Genetic Context: Examining the genomic neighborhood of the MJ1024 gene in M. jannaschii may provide clues about its function through guilt-by-association approaches.

A comprehensive bioinformatic analysis combining these approaches would provide the strongest foundation for experimental design to characterize this protein.

What expression systems are optimal for producing functional thermophilic proteins like MJ1024?

Expressing functional thermophilic proteins from hyperthermophiles like M. jannaschii presents unique challenges due to their adaptation to extreme conditions. Based on the available information and general knowledge about thermophilic protein expression:

  • E. coli Expression: While E. coli is the system used for the commercially available recombinant MJ1024 , it has limitations for thermophilic proteins:

    • May not properly fold at mesophilic temperatures

    • May form inclusion bodies requiring refolding

    • May lack specific post-translational modifications

  • Alternative Expression Systems:

    • Thermophilic Hosts: Thermus thermophilus or Sulfolobus solfataricus could provide a more native-like environment

    • Cell-Free Systems: Allow controlled expression conditions mimicking thermophilic environments

    • Archaeal Expression Systems: Haloferax volcanii or modified Methanococcus maripaludis systems for proteins requiring archaeal-specific processing

  • Optimization Strategies:

    • Co-expression with archaeal chaperones

    • Use of specialized strains like E. coli Rosetta for rare codon usage

    • Expression at lower temperatures with longer induction times

    • Addition of osmolytes or stabilizing agents

  • Verification of Functionality:

    • Thermal stability assays

    • Circular dichroism at elevated temperatures

    • Activity assays at physiologically relevant temperatures (85-95°C for M. jannaschii proteins)

The example of M. jannaschii nucleoside kinase (MjNK) demonstrates that functional expression of thermophilic proteins from this organism is achievable, as it was successfully expressed, purified, and crystallized for structural studies .

What experimental approaches can be used to determine the function of MJ1024?

Determining the function of an uncharacterized protein like MJ1024 requires a multi-faceted approach combining computational predictions with experimental validation:

  • Structural Biology Approaches:

    • X-ray crystallography: Similar to the approach used for M. jannaschii nucleoside kinase

    • Cryo-EM: Particularly valuable if MJ1024 is part of a larger complex

    • NMR spectroscopy: For studying dynamics and ligand interactions

  • Biochemical Characterization:

    • Substrate screening: Testing potential substrates based on structural predictions

    • Enzyme assays: Developing activity assays based on predicted function

    • Ligand binding assays: Surface plasmon resonance or isothermal titration calorimetry

    • Thermal shift assays: To identify stabilizing ligands or cofactors

  • Genetic Approaches:

    • Gene knockout/knockdown: Though challenging in archaea, CRISPR systems have been adapted for some archaeal species

    • Heterologous complementation: Testing if MJ1024 can complement known mutants in model organisms

    • Transcriptional analysis: Identifying conditions where MJ1024 is differentially expressed

  • Protein Interaction Studies:

    • Pull-down assays with tagged MJ1024

    • Bacterial/yeast two-hybrid screening

    • Chemical crosslinking followed by mass spectrometry

    • Proximity labeling approaches

  • Localization Studies:

    • Immunolocalization if antibodies are available

    • Fusion to reporter proteins if genetic systems are available for M. jannaschii

A systematic implementation of these approaches would maximize the chances of determining MJ1024's function, with initial experiments guided by computational predictions to narrow the experimental space.

How can structural analysis help elucidate the function of MJ1024?

Structural analysis provides valuable insights into protein function, especially for uncharacterized proteins like MJ1024. The available AlphaFold model (AF-Q58430-F1) can serve as a starting point , but additional structural studies would significantly enhance functional characterization:

  • Structural Feature Identification:

    • Identify putative active sites or binding pockets

    • Recognize structural motifs associated with specific functions

    • Map conserved residues onto the structure to highlight functionally important regions

    • Analyze surface electrostatics to identify potential interaction interfaces

  • Structural Homology Analysis:

    • Compare the MJ1024 structure with solved structures in the PDB using tools like DALI or VAST

    • Identify structural homologs even in the absence of sequence similarity

    • Map functional information from homologs onto MJ1024 structure

  • Molecular Dynamics Simulations:

    • Perform simulations at elevated temperatures mimicking M. jannaschii's natural environment

    • Identify stable regions and conformational changes

    • Test interactions with potential ligands or substrates

    • Analyze water/ion channels if predicted to be a membrane protein

  • Ligand Docking Studies:

    • Conduct virtual screening of potential ligands

    • Generate hypotheses about substrate specificity

    • Design mutants to test predicted interactions

  • Experimental Structure Determination:

    • Use the computational model to guide construct design for crystallization

    • Consider limited proteolysis to identify stable domains

    • Apply techniques used successfully for other M. jannaschii proteins, such as those employed for MjNK

The case of M. jannaschii nucleoside kinase demonstrates how structural analysis can reveal functional details. Its structure was solved using multiple-wavelength anomalous dispersion and refined to high resolution (1.7 and 1.9 Å), revealing details about substrate binding and conformational changes .

What are the challenges in crystallizing hyperthermophilic proteins like MJ1024?

Crystallizing proteins from hyperthermophilic organisms like M. jannaschii presents unique challenges and opportunities. The successful crystallization of M. jannaschii nucleoside kinase (MjNK) provides valuable insights , but researchers working with MJ1024 should consider:

The successful crystallization of MjNK resulting in structures at 1.7 and 1.9 Å resolution demonstrates that high-quality crystals can be obtained from M. jannaschii proteins with careful optimization .

How can site-directed mutagenesis be used to study MJ1024 function?

Site-directed mutagenesis is a powerful approach for investigating protein function through systematic modification of specific amino acids. For an uncharacterized protein like MJ1024, this approach can provide valuable insights:

  • Target Selection Strategies:

    • Conserved residues identified through sequence alignment

    • Residues in predicted functional sites based on the AlphaFold model

    • Hydrophobic residues in potential transmembrane regions

    • Charged residues that may participate in substrate binding or catalysis

    • Residues unique to thermophilic homologs that may contribute to thermostability

  • Types of Mutations to Consider:

    • Conservative substitutions to subtly alter properties

    • Non-conservative substitutions to dramatically change properties

    • Alanine scanning of predicted functional regions

    • Cysteine mutations for accessibility studies or crosslinking

    • Introduction or removal of potential post-translational modification sites

  • Functional Analysis of Mutants:

    • Thermostability assessment via differential scanning calorimetry

    • Structural integrity verification via circular dichroism

    • Activity assays (once a function is hypothesized)

    • Binding studies with predicted interaction partners

    • In vivo complementation if genetic systems are available

  • Technical Considerations for Thermophilic Proteins:

    • Expression conditions may need re-optimization for each mutant

    • Thermostability changes may affect purification protocols

    • Functional assays should be conducted at physiologically relevant temperatures

    • Consider the effect of mesophilic expression on folding of thermophilic mutants

A systematic mutagenesis approach could start with the identification of a potential functional domain and proceed through iterative rounds of mutation and characterization, with each round informed by previous results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.