Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1032 (MJ1032)

Shipped with Ice Packs
In Stock

Description

Key Features:

PropertyDetails
SpeciesMethanocaldococcus jannaschii (strain ATCC 43067/DSM 2661/JAL-1)
Expression HostEscherichia coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Recombinant Production

MJ1032 is expressed in E. coli and purified via affinity chromatography leveraging the His tag. Key production parameters include:

ParameterSpecification
Storage-20°C/-80°C long-term; 4°C for working aliquots (≤1 week)
ReconstitutionSterile deionized water (0.1–1.0 mg/mL), with glycerol (5–50%) for stability
StabilityAvoid repeated freeze-thaw cycles

Biochemical Properties

  • Thermostability: While not explicitly tested for MJ1032, M. jannaschii proteins often exhibit extreme thermostability due to the organism’s 85°C optimal growth temperature .

  • Functional Annotations: MJ1032 is not linked to characterized metabolic pathways or enzymatic activities in current databases . Homology-based predictions are absent due to its uncharacterized status.

Research Applications

Though its biological role is unknown, recombinant MJ1032 is utilized in:

  1. Structural Studies: Potential target for crystallography or cryo-EM to resolve archaeal protein-folding mechanisms.

  2. Antibody Development: Serves as an antigen for generating antibodies against uncharacterized archaeal proteins .

  3. Functional Screens: Used in high-throughput assays to identify enzymatic or binding activities .

Contextual Insights from M. jannaschii Biology

  • Genomic Context: M. jannaschii’s genome (1.66 Mbp main chromosome) encodes numerous uncharacterized proteins, reflecting limited annotation of archaeal systems .

  • Proteomic Complexity: The organism’s proteome includes 19 inteins (self-splicing protein elements), though MJ1032 lacks documented intein domains .

  • Research Precedent: Genetic tools for M. jannaschii (e.g., CRISPR-based systems) enable future functional studies of MJ1032 .

Future Directions

  1. Functional Characterization: Employ genetic knockouts or interactome analyses to identify MJ1032’s role in M. jannaschii.

  2. Structural Resolution: Use recombinant MJ1032 for crystallography to infer function from tertiary structure.

  3. Comparative Genomics: Compare MJ1032 orthologs across methanogens to identify conserved motifs.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that specific requirements may arise. Please indicate any format preferences when placing your order, and we will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for precise delivery estimations.
Note: Our standard shipping practice involves using blue ice packs. If you require dry ice for transportation, please communicate this need in advance as an additional fee will be applied.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. To preserve the protein for extended periods, we advise adding 5-50% glycerol (final concentration) and aliquoting it for storage at -20°C/-80°C. Our standard protocol includes a final glycerol concentration of 50%, which serves as a reference point for your considerations.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
For liquid forms, a shelf life of 6 months is typically expected at -20°C/-80°C. Lyophilized forms generally exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
MJ1032; Uncharacterized protein MJ1032
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-366
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1032
Target Protein Sequence
MEKEGVKNYLVLVVDIDDDIGRKAGLNTPILGREENIKALIKLGLADPGDSDVNAILGGV KIYDELKASGKDVEIATISGDVDVESEKCALRIKEQIDFLLYLYNPDFIYLVSDGKEDEM ILKYLESKNIFVWKKRVIVKQSETLESTYYLIQEFIKKTMEEYIPLILTFIGFSLILYAI FADIGWRIVVGIIGLYILSEGVGVRKLLMEKIKKKEEFDVGRVFPISASISIFILIIGLI YSLSSINKTSSTLTEFIGEFLLHFVDSLTLSLLILMVGKFVDTIINSEKDLLEILKKYFF CLICIFISRELIISGGEYLLKKISFIMFVMCVIIYISIVIILSVILFTKSSKEDKFKKLK NSITKG
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1032

STRING: 243232.MJ_1032

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii Uncharacterized Protein MJ1032?

MJ1032 is a protein from the hyperthermophilic methanogenic archaeon Methanocaldococcus jannaschii that has not yet been functionally characterized. It consists of 366 amino acids and is categorized as "uncharacterized" because its biological function, structure, and role in cellular processes have not been fully determined through experimental validation . The protein is part of the M. jannaschii proteome, an organism known for its ability to thrive in extreme environments including high temperatures and pressures at deep-sea hydrothermal vents. Understanding proteins like MJ1032 is crucial for deciphering archaeal biology and potentially discovering novel biochemical activities adapted to extreme conditions.

How is Recombinant MJ1032 Typically Produced for Research Purposes?

Recombinant MJ1032 is typically produced using Escherichia coli as the expression host. The process involves cloning the MJ1032 gene into an expression vector with a His-tag, transformation into E. coli, followed by induction of protein expression . The His-tag enables efficient purification using nickel affinity chromatography. For optimal expression of archaeal proteins, specialized E. coli strains that can accommodate the different codon usage patterns found in archaeal genomes are often employed. Temperature optimization during expression is particularly important for proteins from thermophilic organisms like M. jannaschii, as they may not fold properly at standard E. coli growth temperatures. Purification typically involves cell lysis, centrifugation to remove cellular debris, and affinity chromatography followed by additional chromatographic steps if higher purity is required.

What are the Basic Physicochemical Properties to Consider When Working with MJ1032?

When working with MJ1032, researchers should consider key physicochemical properties that influence experimental design. Similar to approaches used for other uncharacterized proteins, properties such as molecular weight, isoelectric point (pI), extinction coefficient, grand average of hydropathicity (GRAVY), and instability index should be determined . These parameters can be estimated using computational tools like Expasy's ProtParam program, which requires only the protein sequence. The GRAVY value would indicate whether MJ1032 is hydrophilic (negative value) or hydrophobic (positive value), providing insights into potential membrane association. The instability index (below 40 indicates stability) helps predict the protein's stability in experimental conditions. For thermophilic proteins like MJ1032, thermal stability measurements are particularly relevant and can be assessed through differential scanning calorimetry or thermal shift assays.

Why Study Uncharacterized Proteins Like MJ1032?

Studying uncharacterized proteins like MJ1032 is essential for several compelling scientific reasons. First, annotation of these proteins is crucial for obtaining new facts about organisms and deciphering gene regulation, functions, and metabolic pathways . Uncharacterized proteins often represent substantial portions of sequenced genomes—in some cases, up to 30-40% of predicted open reading frames have unknown functions. These proteins may hold the key to novel biochemical activities, particularly in organisms like M. jannaschii that inhabit extreme environments. Additionally, characterizing these proteins can lead to the discovery of novel enzymatic activities with potential biotechnological applications. In archaeal systems specifically, uncharacterized proteins may reveal unique adaptations to extreme conditions and provide insights into early evolution, as Archaea represent a distinct domain of life with unique cellular processes.

What Initial Bioinformatic Approaches Should Researchers Use to Begin Characterizing MJ1032?

Researchers should employ a systematic bioinformatic workflow as the first step in characterizing MJ1032. Begin with sequence homology searches using BLAST against various databases to identify potential homologs in other organisms. Next, conduct domain and motif searches using tools like InterProScan, SMART, HMMER, and NCBI CDART to identify conserved regions that might suggest function . Protein family analysis through Pfam, COG, or KOG databases can place MJ1032 within evolutionary context. Secondary structure prediction using tools like PSIPRED can provide insights into potential functional elements. Subcellular localization prediction is also important and can be performed using specialized tools for archaeal proteins. Integration of results from multiple prediction tools is essential, as the approach used for F. nucleatum uncharacterized proteins demonstrated an average accuracy of 83% across different parameters . This combined approach increases confidence in functional predictions and helps prioritize experimental validation strategies.

What Advanced Bioinformatic Strategies Can Improve Functional Annotation of MJ1032?

Advanced bioinformatic strategies for improved functional annotation of MJ1032 should integrate multiple computational approaches beyond basic sequence analysis. Researchers should implement a hierarchical workflow that begins with sensitive homology detection methods such as PSI-BLAST and HHpred, which can identify distant evolutionary relationships not detectable by standard BLAST. Protein fold recognition using threading algorithms (e.g., I-TASSER, Phyre2) can predict three-dimensional structures even in the absence of close homologs . Genomic context analysis examining gene neighborhood, fusion events, and co-occurrence patterns across species can provide functional insights based on the principle that functionally related genes often cluster together or show similar evolutionary profiles. Machine learning approaches that integrate multiple features (sequence, structure, genomic context) can improve prediction accuracy. Additionally, molecular dynamics simulations of predicted structures can help identify potential binding sites or catalytic regions. For increased confidence, follow the approach used for F. nucleatum uncharacterized proteins where functions were assigned only when conserved domains were predicted by two or more databases, resulting in higher confidence annotations .

How Can Researchers Design Effective Protein-Protein Interaction Studies for MJ1032?

Designing effective protein-protein interaction studies for MJ1032 requires a multi-faceted approach beginning with computational prediction followed by experimental validation. Initially, perform in silico interaction predictions using tools like STRING database to generate hypotheses about potential interaction partners . For experimental validation, consider the thermophilic nature of M. jannaschii when selecting methods. Yeast two-hybrid systems with thermostable components or bacterial two-hybrid systems may be appropriate initial screens. Pull-down assays using the His-tagged recombinant MJ1032 as bait can identify interaction partners from M. jannaschii lysates . For direct interactions, surface plasmon resonance or isothermal titration calorimetry performed at elevated temperatures can provide quantitative binding parameters. Crosslinking mass spectrometry is particularly valuable for capturing transient interactions. Co-immunoprecipitation with custom antibodies against MJ1032 can validate interactions in native contexts if culturable M. jannaschii is available. When designing these experiments, consider potential temperature-dependent conformational changes that might affect interaction profiles, and include appropriate controls for non-specific binding, which can be particularly challenging with thermostable proteins.

What Experimental Strategies Are Most Effective for Validating Predicted Functions of MJ1032?

Validating predicted functions of MJ1032 requires a comprehensive experimental strategy that builds upon bioinformatic predictions. If domain analysis suggests enzymatic activity, develop activity assays using potential substrates at conditions mimicking M. jannaschii's native environment (85-90°C, high pressure). Site-directed mutagenesis of predicted catalytic residues can confirm their importance for function. Structural studies using X-ray crystallography or cryo-EM can provide detailed insights into potential active sites or binding pockets. Gene knockout or knockdown studies, although challenging in archaeal systems, can reveal phenotypic changes indicating function. Heterologous expression in model organisms followed by functional complementation assays can test if MJ1032 can replace proteins of known function. Transcriptomic and proteomic analyses comparing wild-type and mutant strains under various conditions can reveal co-regulated genes and provide functional context. Consider implementing a within-subject experimental design where appropriate to reduce variability and increase statistical power, particularly for complex phenotypic analyses . The validation strategy should be iterative, with each experiment informing the design of subsequent studies, and should include appropriate controls to rule out alternative explanations.

How Can Within-Subject Experimental Designs Enhance Research on MJ1032 Function?

Within-subject experimental designs can significantly enhance research on MJ1032 function by reducing variability and increasing statistical power. In such designs, each experimental unit (e.g., cell culture, organism) serves as its own control, which is particularly valuable when studying subtle phenotypic effects . When investigating MJ1032 function in heterologous systems, researchers can implement a repeated measures design where the same cultures are measured before and after induction of MJ1032 expression. This approach effectively treats each culture as a block, accounting for the inherent variability between cultures and isolating the effect of MJ1032 expression . The statistical analysis for such designs would involve paired comparisons or repeated measures ANOVA, which separates the variability between subjects from the experimental effect, resulting in greater sensitivity. As illustrated in the carbon emissions example, the F-test in a block design can yield identical results to a paired t-test, demonstrating the statistical equivalence of these approaches . For more complex designs involving multiple time points or conditions, mixed-effects models can account for both within-subject correlations and fixed treatment effects, providing robust analysis of MJ1032's impact on cellular physiology.

How Should Researchers Approach Gene Expression Studies to Understand MJ1032 Regulation?

Approaching gene expression studies for MJ1032 regulation requires consideration of M. jannaschii's extreme growth conditions and archaeal gene regulation mechanisms. Design experiments to measure MJ1032 expression under various environmental conditions relevant to M. jannaschii's natural habitat, including temperature ranges (70-95°C), pressure variations, nutrient limitations, and different carbon and energy sources. RT-qPCR remains valuable for targeted expression analysis but requires careful primer design and optimization for extreme GC content. RNA-Seq provides a comprehensive view of the transcriptome and can reveal co-regulated genes, potentially identifying functional networks involving MJ1032. ChIP-seq targeting archaeal transcription factors can identify proteins regulating MJ1032 expression. For promoter analysis, consider archaeal-specific promoter elements which differ from bacterial and eukaryotic systems. Reporter gene assays using thermostable reporters can validate promoter function. When analyzing results, implement statistical approaches that account for batch effects and technical variability, potentially using a blocking design where experimental batches are treated as blocks . This approach separates batch-to-batch variability from the treatment effects of interest, increasing sensitivity to detect subtle expression changes. Cross-validate findings using multiple techniques and biological replicates to ensure reproducibility of results in these challenging experimental systems.

What Approaches Can Resolve Contradictions Between Computational Predictions and Experimental Data for MJ1032?

Resolving contradictions between computational predictions and experimental data for MJ1032 requires systematic investigation of potential sources of discrepancy. First, evaluate the confidence levels of computational predictions; predictions made by multiple independent tools carry greater weight than those from single sources . For contradictory experimental results, examine differences in experimental conditions, particularly temperature, pH, and salt concentration, which can dramatically affect archaeal protein function. Consider that MJ1032 may be multifunctional or exhibit condition-specific activities not captured in standard assays. Protein modifications, particularly those unique to archaea, might affect function in ways not predicted computationally. Structure-based approaches can be enlightening—obtain experimental structures where possible or generate high-quality models, then perform virtual docking or molecular dynamics simulations to test hypothetical functions. Design experiments specifically to test alternative hypotheses generated from contradictory data. Employ statistical designs that can account for multiple variables, such as factorial designs to examine interaction effects between conditions . When analyzing complex datasets with multiple sources of variation, consider mixed-effects models that can separate variability between experimental units (random effects) from the treatment effects of interest (fixed effects), providing clearer statistical inference and potentially resolving apparent contradictions in the data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.