Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1072 (MJ1072)

Shipped with Ice Packs
In Stock

Description

Introduction to Methanocaldococcus jannaschii and MJ1072

Methanocaldococcus jannaschii (formerly known as Methanococcus jannaschii) is a hyperthermophilic methanogenic archaeon first isolated from a "white smoker" submarine hydrothermal vent. This remarkable organism thrives in extreme environments, growing optimally at temperatures approaching 85°C, pressures exceeding 200 atmospheres, and represents one of the first archaeal genomes ever sequenced. The unique evolutionary position of M. jannaschii between bacteria and eukaryotes makes it a valuable model for studying fundamental biological processes and adaptations to extreme conditions. Its genome contains numerous uncharacterized genes, including MJ1072, which encodes a protein of unknown function but potentially significant biological importance.

MJ1072 is classified as an uncharacterized protein, indicating that its precise biological function has not yet been conclusively determined. The protein belongs to the M. jannaschii MJ0023/MJ0349/MJ1072/MJ1074/MJ1107/MJECL16 family, suggesting functional or structural relationships with other proteins in this organism . The recombinant production of MJ1072 has emerged as a critical approach to studying this protein, as it allows researchers to overcome the challenges associated with cultivating the native extremophilic organism while enabling detailed molecular and biochemical analyses under controlled laboratory conditions.

Expression Systems

The successful recombinant expression of MJ1072 represents a significant technical achievement, enabling researchers to study this protein outside its challenging native environment. Escherichia coli has been established as an effective heterologous expression system for producing the recombinant MJ1072 protein . The full-length protein (amino acids 1-116) has been successfully expressed with an N-terminal histidine tag (His-tag), which facilitates subsequent purification through metal affinity chromatography .

Biochemical Properties and Functional Insights

Despite its designation as an "uncharacterized" protein, several biochemical properties of MJ1072 can be inferred from available information. The amino acid composition and sequence analysis suggest a protein with both hydrophobic and hydrophilic regions, potentially indicating membrane association or interaction capabilities. The presence of specific amino acid motifs within the sequence might provide clues about potential binding partners or catalytic activities, although specific enzymatic functions have not been conclusively identified in the current literature.

Given the extremophilic nature of M. jannaschii, MJ1072 is likely to exhibit remarkable stability under harsh conditions, including high temperatures, extreme pH values, and potentially high pressure environments. These intrinsic stability properties make MJ1072 an interesting subject for studying protein adaptation mechanisms in extremophiles. Such studies could have significant implications for both fundamental protein science and potential biotechnological applications requiring stable proteins.

It is worth noting that functional characterization of M. jannaschii proteins can sometimes challenge initial annotations. For instance, another M. jannaschii protein, MJ0968, was initially reported as a soluble P-type ATPase but was later found to exhibit primarily phosphatase activity rather than ATPase activity . This example highlights the importance of rigorous biochemical characterization for uncharacterized proteins from M. jannaschii and suggests that experimental validation of predicted functions is essential for proteins like MJ1072.

Reconstitution Procedures

Proper reconstitution of lyophilized MJ1072 is critical for experimental success and reproducibility. Manufacturer guidelines recommend briefly centrifuging the protein vial prior to opening to ensure all material is collected at the bottom of the container . The protein should be reconstituted in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, depending on the specific requirements of the intended experiments .

For long-term storage of reconstituted protein, addition of 5-50% glycerol (final concentration) is recommended to prevent freeze damage and maintain protein stability . The default recommendation of 50% glycerol provides optimal protection during freezing while maintaining protein solubility . These detailed reconstitution procedures ensure that researchers can prepare the protein in a form suitable for various experimental applications while maximizing stability and activity.

Research Applications and Future Directions

Recombinant MJ1072 offers numerous research applications across multiple disciplines, including structural biology, biochemistry, protein evolution, and biotechnology. The availability of high-quality recombinant protein enables researchers to conduct detailed studies that would be challenging or impossible using native protein from M. jannaschii. Several promising research directions can be identified for this intriguing protein.

Structural characterization through techniques such as X-ray crystallography, nuclear magnetic resonance (NMR) spectroscopy, or cryo-electron microscopy would provide valuable insights into the three-dimensional conformation of MJ1072 and potentially reveal structural features related to its function. Such structural information could also facilitate comparative analyses with other members of its protein family to understand evolutionary relationships and functional divergence.

Functional characterization through biochemical assays could potentially identify enzymatic activities, binding partners, or other functional properties of MJ1072. Systematic screening approaches, including activity-based protein profiling or interaction proteomics, might uncover the biological role of this uncharacterized protein in M. jannaschii metabolism or cellular processes. Comparative studies with other members of its protein family, particularly MJ1074, could provide additional insights into potential functions and evolutionary specialization.

From a biotechnological perspective, the inherent stability of proteins from extremophilic organisms makes MJ1072 a potentially valuable candidate for various applications. If specific catalytic activities or binding properties are identified, these could be harnessed for biotechnological processes requiring stable proteins capable of functioning under harsh conditions. Additionally, understanding the structural basis of MJ1072's stability could inform protein engineering efforts aimed at enhancing the stability of mesophilic proteins for industrial applications.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for the specific delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
MJ1072; Uncharacterized protein MJ1072
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1072
Target Protein Sequence
MIYFGGIMAIAYAKLYEIIAKYIKDEKRAEELYNAVVEVIKEEKIIVKHELKDELKNELA TKEDIMLAEERILRYVDNRFNQLDKKMTVGFVILILLYILTNPNAIELIKLLFGVK
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1072

STRING: 243232.MJ_1072

Protein Families
M.jannaschii MJ0023/MJ0349/MJ1072/MJ1074/MJ1107/MJECL16 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for research?

M. jannaschii is an extremophile that thrives in temperatures ranging from 48-94°C in deep-sea volcanic environments . Its genome consists of a large circular chromosome (1.66 megabase pairs with 31.4% G+C content), plus large and small circular extrachromosomal elements . The organism's adaptation to extreme conditions and ancient metabolic pathways make it invaluable for studying early life on Earth and potentially habitable environments on other planets.

Why study an uncharacterized protein like MJ1072?

Researching uncharacterized proteins like MJ1072 is valuable for several reasons:

  • Evolutionary insights: As part of the archaeal domain, novel proteins may represent evolutionary links between bacteria and eukaryotes or reveal unique archaeal adaptations.

  • Thermostable enzyme discovery: M. jannaschii proteins often possess remarkable thermostability, making them candidates for industrial and biotechnological applications.

  • Understanding extremophile biology: Characterizing the proteome of extremophiles helps elucidate survival mechanisms in harsh environments.

  • Novel biological pathways: Uncharacterized proteins may be involved in unique metabolic processes specific to methanogens or archaea.

  • Structural biology advances: Novel protein folds and structural motifs can expand our understanding of protein architecture and function relationships.

The recent development of genetic tools for M. jannaschii makes this research increasingly feasible, as researchers can now knockout or modify genes and add affinity tags to proteins, enabling more sophisticated functional studies .

What expression systems are most effective for producing recombinant MJ1072?

Recommended expression system protocol:

  • Codon optimization: M. jannaschii uses different codon preferences than E. coli. Either optimize the MJ1072 gene sequence for E. coli expression or co-express rare tRNAs. For example, utilizing the pRI952 plasmid that contains the argU and ileX tRNA genes accommodates codons that are rare in E. coli .

  • Expression vector selection: pET-series vectors with T7 promoters typically yield good results for archaeal proteins. For MJ1072, vectors enabling C-terminal or N-terminal His-tagging facilitate purification .

  • Host strain selection: E. coli BL21(DE3) derivatives specifically designed for expression of proteins from AT-rich genomes (like M. jannaschii with its 31.4% GC content) are preferable .

  • Expression temperature: Despite M. jannaschii being a thermophile, optimal expression in E. coli is typically achieved at reduced temperatures (16-25°C) to enhance proper folding and solubility.

  • Induction conditions: IPTG concentrations between 0.1-0.5 mM with extended expression times (16-20h) at lower temperatures often maximize yield of soluble protein.

Alternatively, homologous expression in M. jannaschii itself has become possible with recent genetic tools, allowing the protein to be expressed with native post-translational modifications and proper folding in its natural thermophilic environment .

What purification strategies yield the highest purity and stability for MJ1072?

Purification of recombinant MJ1072 typically follows this multi-step process to ensure high purity and stability:

  • Initial capture: For His-tagged MJ1072, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin provides effective initial purification. Buffer conditions should include:

    • 50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0)

    • 300-500 mM NaCl to reduce non-specific binding

    • 10-20 mM imidazole in binding buffer

    • 250-300 mM imidazole for elution

    • 10% glycerol and 1-5 mM DTT or β-mercaptoethanol as stabilizing agents

  • Secondary purification: Size exclusion chromatography (SEC) further removes aggregates and contaminants while providing information about the oligomeric state of MJ1072.

  • Stability considerations: Adding 50% glycerol to the final storage buffer enhances long-term stability, and storage at -20°C or -80°C is recommended with avoidance of repeated freeze-thaw cycles .

  • Quality assessment: SDS-PAGE (>95% purity), western blotting (identity confirmation), and mass spectrometry (exact mass determination) should be performed to verify protein quality.

It's worth noting that thermostable proteins from M. jannaschii often benefit from a heat treatment step (65-75°C for 10-15 minutes) during purification, which precipitates many E. coli proteins while leaving the thermostable target protein in solution.

What computational approaches can predict the structure and potential function of MJ1072?

Several bioinformatic approaches can provide insights into the potential structure and function of uncharacterized proteins like MJ1072:

  • Sequence homology analysis: While MJ1072 lacks clear homologs with known function, distant homology detection tools like HHpred, HMMER, or PSIBLAST may identify remote relationships to characterized protein families.

  • Structural prediction: Modern AI-based structure prediction tools such as AlphaFold2 and RoseTTAFold can generate reliable structural models even for proteins with no detectable sequence homology to known structures. These predictions can be further refined through molecular dynamics simulations optimized for thermostable proteins.

  • Functional site prediction: Tools like ConSurf, 3DLigandSite, and COACH can identify potential ligand-binding sites, active sites, or protein-protein interaction interfaces based on structural conservation or physicochemical properties.

  • Genomic context analysis: Examining the genomic neighborhood of MJ1072 may provide clues about its function, as functionally related genes are often co-located or co-expressed.

  • Phylogenetic profiling: Identifying organisms that contain MJ1072 homologs and correlating this with specific metabolic capabilities may suggest functional associations.

When applying these methods to MJ1072, particular attention should be paid to features that might indicate adaptation to extreme conditions, such as increased hydrophobic core packing, reduced surface loop length, and enhanced ionic interactions that contribute to thermostability.

What experimental approaches can determine the structure of MJ1072?

Experimental structure determination of MJ1072 can follow several complementary approaches:

Several M. jannaschii proteins have been successfully crystallized and their structures determined, including MJ0754 and MJ0026 , providing precedent and potential methodological guidance.

How can the biological function of MJ1072 be experimentally determined?

Determining the function of uncharacterized proteins like MJ1072 requires a multi-faceted approach:

  • Gene knockout studies: With the recent development of genetic tools for M. jannaschii , knockout or depletion of the MJ1072 gene can reveal phenotypic consequences:

    • Monitor growth under various conditions (temperature ranges, pressure, nutrient availability)

    • Analyze metabolomic changes in knockout strains

    • Assess survival under stress conditions (oxidative stress, pH fluctuations)

  • Protein-protein interaction studies:

    • Affinity purification coupled with mass spectrometry (AP-MS) using tagged MJ1072

    • Yeast two-hybrid screening adapted for thermophilic proteins

    • Proximity labeling methods (BioID, APEX) in heterologous systems

  • Biochemical activity assays:

    • Screen for enzymatic activities based on structural predictions

    • Test binding to various substrates (nucleic acids, metabolites, lipids)

    • Assess membrane association and potential transport functions

  • Localization studies:

    • Fluorescent protein tagging or immunolocalization to determine subcellular distribution

    • Membrane fractionation studies to assess association with specific cellular compartments

  • Comparative transcriptomics/proteomics:

    • Analyze expression patterns under different growth conditions

    • Compare with known stress response proteins to identify functional associations

The genetic system developed for M. jannaschii makes it possible to create strains expressing affinity-tagged versions of MJ1072, facilitating many of these experiments directly in the native organism rather than relying solely on heterologous systems .

How can recombinant MJ1072 be used to study archaeal membrane biology?

If MJ1072 is indeed membrane-associated as suggested by its sequence characteristics, it can serve as a valuable tool for studying archaeal membrane biology:

  • Lipid interaction studies:

    • Reconstitution into liposomes composed of archaeal lipids (tetraether lipids)

    • Surface plasmon resonance (SPR) to measure binding kinetics with various lipids

    • Differential scanning calorimetry to assess effects on membrane fluidity and phase transitions

  • Membrane protein complex analysis:

    • Blue native PAGE to identify native membrane complexes containing MJ1072

    • Co-immunoprecipitation with tagged MJ1072 to identify interaction partners

    • Crosslinking mass spectrometry to map protein-protein interfaces

  • Adaptation to extreme conditions:

    • Compare membrane association at different temperatures to understand thermoadaptation

    • Assess pressure effects on membrane localization and function

    • Examine how membrane composition affects MJ1072 activity

  • Evolutionary comparisons:

    • Compare membrane interactions of MJ1072 with homologs from mesophilic archaea

    • Identify conserved vs. variable regions that may contribute to thermal adaptation

The archaeal cell membrane differs fundamentally from bacterial and eukaryotic membranes, featuring isoprenoid side chains connected to glycerol by ether linkages rather than fatty acids with ester linkages. Understanding how proteins like MJ1072 interact with these unique membranes can provide insights into archaeal physiology and adaptation to extreme environments.

What role might MJ1072 play in thermoadaptation mechanisms?

As a protein from a hyperthermophile that grows optimally at temperatures approaching 85°C, MJ1072 may contribute to thermoadaptation through several potential mechanisms:

  • Membrane stabilization: If membrane-associated, MJ1072 might help maintain membrane integrity at high temperatures by:

    • Modulating membrane fluidity

    • Reinforcing membrane structure through protein-lipid interactions

    • Participating in tetraether lipid organization specific to thermophiles

  • Stress response: MJ1072 could be involved in sensing or responding to temperature fluctuations:

    • Expression analysis across temperature ranges can reveal whether MJ1072 is upregulated during heat stress

    • Comparison with expression patterns of known heat shock proteins

    • Assessment of whether MJ1072 knockout strains show temperature sensitivity

  • Protein stabilization: MJ1072 might function as a chaperone or co-chaperone:

    • Testing for ability to prevent aggregation of model substrates

    • Examining co-localization with known chaperone systems

    • Assessing ATP-dependent or -independent folding assistance capabilities

  • Metabolic adaptation: MJ1072 could participate in metabolic pathways that are critical at high temperatures:

    • Metagenomic analysis to correlate MJ1072 presence with specific thermophilic metabolic capabilities

    • Metabolomic comparison between wild-type and MJ1072 knockout strains

    • Testing for temperature-dependent enzymatic activities

Experimental approaches to test these hypotheses would include comparing phenotypes of MJ1072 knockout strains at different temperatures, identifying interaction partners under various temperature conditions, and analyzing the temperature dependence of any biochemical activities identified for MJ1072.

How do the structural features of MJ1072 compare with its homologs in mesophilic archaea?

Comparative structural analysis between thermophilic and mesophilic protein homologs can reveal adaptations that contribute to thermostability. For MJ1072, this would involve:

  • Identification of mesophilic homologs:

    • Perform sensitive sequence searches using PSI-BLAST, HMMER, or HHpred across archaeal genomes

    • Focus on close phylogenetic relatives with different temperature optima

    • Select 3-5 homologs spanning a range of growth temperatures for comparative analysis

  • Comparative structural analysis:

    • Generate structural models for each homolog

    • Analyze amino acid composition differences:

      FeatureMJ1072 (thermophile)Mesophilic homologsTypical adaptation
      Charged residues (%)To be determinedTo be determinedHigher in thermophiles
      Hydrophobic core packingTo be determinedTo be determinedTighter in thermophiles
      Disulfide bondsTo be determinedTo be determinedOften more in thermophiles
      Surface loopsTo be determinedTo be determinedShorter in thermophiles
      Proline contentTo be determinedTo be determinedHigher in thermophiles
      Glycine contentTo be determinedTo be determinedLower in thermophiles
    • Compare predicted melting temperatures (Tm) based on amino acid composition

    • Assess differences in predicted flexibility using molecular dynamics simulations

  • Experimental validation:

    • Express and purify both MJ1072 and mesophilic homologs

    • Compare thermal stability using differential scanning calorimetry or thermal shift assays

    • Perform activity assays (once function is determined) at various temperatures

    • Use hydrogen-deuterium exchange mass spectrometry to compare conformational dynamics

This comparative approach can identify specific residues or structural features responsible for thermoadaptation, potentially allowing for the rational design of thermostabilized proteins for biotechnological applications.

What is the evolutionary history of MJ1072 across the archaeal domain?

Understanding the evolutionary trajectory of MJ1072 can provide insights into both its function and the evolutionary history of Archaea:

  • Comprehensive phylogenetic analysis:

    • Construct a detailed phylogenetic tree of MJ1072 homologs across archaeal species

    • Map the presence/absence pattern across the archaeal phylogeny

    • Identify potential horizontal gene transfer events

    • Compare tree topology with established archaeal phylogeny to identify inconsistencies

  • Evolutionary rate analysis:

    • Calculate the ratio of non-synonymous to synonymous substitutions (dN/dS) to identify selection pressure

    • Compare evolutionary rates between thermophilic and mesophilic lineages

    • Identify specific sites under positive or purifying selection

  • Domain architecture and gene fusion events:

    • Examine whether MJ1072 appears as part of larger proteins in some lineages

    • Identify potential domain gain/loss events during evolution

    • Analyze whether gene neighborhood is conserved across species

  • Correlation with ecological niches:

    • Assess whether MJ1072 presence correlates with specific environmental adaptations

    • Compare protein sequences from species with similar ecological niches but distant phylogenetic relationships

    • Identify convergent evolutionary patterns associated with specific environments

  • Ancestral sequence reconstruction:

    • Infer the sequence of ancestral MJ1072 proteins

    • Express and characterize ancestral proteins to understand functional evolution

    • Compare properties of reconstructed ancestral proteins with extant versions

This evolutionary analysis can help determine whether MJ1072 represents an ancient archaeal protein predating the divergence of major archaeal lineages, or if it emerged later in specific lineages, providing context for its biological significance.

How does post-translational modification affect the function and stability of MJ1072 in its native environment?

Post-translational modifications (PTMs) can significantly impact protein function, especially in extremophiles where they may contribute to thermostability. For MJ1072, investigating PTMs involves:

  • Identification of potential PTMs:

    • Express and purify MJ1072 directly from M. jannaschii using the recently developed genetic system

    • Analyze using high-resolution mass spectrometry to identify modifications

    • Focus on archaeal-specific modifications such as:

      • N-linked glycosylation

      • Methylation

      • Acetylation

      • Phosphorylation

      • Cysteine modifications

  • Functional impact assessment:

    • Generate variants lacking specific modification sites

    • Compare thermal stability of modified vs. unmodified protein

    • Assess whether modifications affect potential enzymatic activity or protein-protein interactions

    • Determine if modifications are regulated by environmental conditions

  • Structural implications:

    • Analyze how identified PTMs affect protein structure using molecular dynamics simulations

    • Determine whether modifications cluster in functionally important regions

    • Compare with PTM patterns in mesophilic homologs if available

  • Enzyme systems responsible:

    • Identify the enzymes responsible for adding specific modifications

    • Determine whether these enzyme systems are conserved across archaea

    • Investigate whether the modification machinery is temperature-regulated

This research direction is particularly valuable as most studies of recombinant archaeal proteins use heterologous expression systems that may not replicate the native PTM patterns, potentially missing important aspects of protein function and regulation.

What are the common challenges in expressing and purifying MJ1072, and how can they be addressed?

Working with archaeal proteins like MJ1072 presents several technical challenges:

  • Poor expression in heterologous hosts:

    • Problem: Codon bias differences between M. jannaschii and E. coli

    • Solution: Use codon-optimized synthetic genes or E. coli strains carrying plasmids with rare tRNAs like pRI952

  • Protein insolubility:

    • Problem: Improper folding in mesophilic host

    • Solutions:

      • Lower induction temperature (16-20°C)

      • Use solubility-enhancing fusion tags (SUMO, MBP, TrxA)

      • Add osmolytes or folding enhancers to growth medium (glycine betaine, proline)

      • Try detergent solubilization if predicted to be membrane-associated

  • Protein instability:

    • Problem: Rapid degradation during expression or purification

    • Solutions:

      • Include protease inhibitors throughout purification

      • Use E. coli strains lacking specific proteases (BL21)

      • Optimize buffer conditions (add stabilizing agents like glycerol, arginine)

  • Low purity after affinity chromatography:

    • Problem: Non-specific binding of E. coli proteins

    • Solutions:

      • Increase imidazole concentration in wash buffers

      • Add a heat treatment step (65-75°C for 10-15 minutes)

      • Include secondary purification steps (ion exchange, size exclusion)

These challenges are common when working with proteins from extremophiles but can generally be overcome through systematic optimization of expression and purification conditions.

How can researchers optimize experimental conditions to study thermostable proteins like MJ1072?

Studying thermostable proteins requires adapting standard protocols to account for their unique properties:

  • Biochemical assays at elevated temperatures:

    • Use thermostable buffer components that maintain pH at high temperatures

    • Employ thermostable enzyme coupling systems for activity assays

    • Utilize specialized high-temperature spectrophotometers or plate readers

    • Account for increased evaporation during extended incubations

  • Structural biology considerations:

    • For crystallography: Perform crystallization at elevated temperatures (30-40°C)

    • For NMR: Set up experiments to collect data at higher temperatures

    • For cryo-EM: Be aware that thermostable proteins may behave differently during vitrification

  • Stability measurement protocols:

    • Thermal shift assays: Extend temperature range up to 95-100°C

    • Circular dichroism: Use quartz cells with tighter seals to prevent evaporation

    • Differential scanning calorimetry: Ensure proper baseline up to 110°C

  • Protein-protein interaction studies:

    • Conduct pull-down assays at physiologically relevant temperatures (65-85°C)

    • Use crosslinking approaches optimized for thermophilic conditions

    • Verify interactions using thermostable reporter systems

  • Equipment considerations:

    • Ensure water baths, incubators, and thermal cyclers can reach and maintain 85-95°C

    • Use heat-resistant laboratory plasticware

    • Consider pressure effects when designing experiments to mimic native conditions

By adapting experimental protocols to account for the thermophilic nature of M. jannaschii proteins, researchers can obtain more physiologically relevant results that better reflect the protein's natural function.

What strategies can resolve contradictory functional predictions for MJ1072?

When faced with contradictory functional predictions for uncharacterized proteins like MJ1072, a systematic approach can help resolve inconsistencies:

  • Evaluate prediction confidence:

    • Compare statistical significance scores from different prediction algorithms

    • Assess the evolutionary distance between MJ1072 and proteins used for functional inference

    • Determine whether predictions are based on full-length sequence or only partial domains

  • Design discriminating experiments:

    • Identify assays that can specifically distinguish between contradictory functional predictions

    • Prioritize direct biochemical assays over indirect methods

    • Test multiple possible functions in parallel rather than sequentially

  • Contextual analysis framework:

    • Evaluate predicted functions in the context of M. jannaschii biology and metabolism

    • Consider whether genomic context supports any of the predicted functions

    • Assess whether environmental conditions of M. jannaschii habitat favor particular functions

  • Integration of multiple data types:

    Data TypeApproachContribution to Functional Assignment
    Genomic contextAnalyze neighboring genesIdentify potential metabolic pathways
    TranscriptomicsRNA-seq under different conditionsDetermine co-regulated genes
    ProteomicsInteraction mappingIdentify protein complexes and pathways
    MetabolomicsComparative profiling of knockout strainsIdentify affected metabolic processes
    Structural analysisIdentify binding pockets and active sitesSuggest potential substrates
  • Evolutionary approach to resolve contradictions:

    • Examine function conservation patterns across homologs

    • Test for multi-functionality that might explain divergent predictions

    • Consider whether the protein function has changed during evolution

By systematically evaluating contradictory predictions through multiple complementary approaches, researchers can converge on the most likely biological function(s) of MJ1072 and design definitive experimental validations.

How can MJ1072 research contribute to our understanding of archaeal evolution and early life on Earth?

Studying uncharacterized proteins like MJ1072 from deeply-branching archaeal lineages offers unique opportunities to address fundamental questions about archaeal evolution and early life:

  • Last Universal Common Ancestor (LUCA) studies:

    • Determine whether MJ1072 has homologs across all domains of life

    • Assess whether it represents an ancient protein present in LUCA

    • Compare with minimal gene sets predicted for early life forms

  • Adaptation to primordial Earth conditions:

    • Test MJ1072 function under conditions mimicking early Earth (high temperature, anaerobic, high CO₂, high pressure)

    • Examine whether MJ1072 interacts with ancient metabolic pathways

    • Assess potential roles in adaptation to fluctuating extreme conditions

  • Archaeal-specific biological processes:

    • Determine whether MJ1072 participates in unique archaeal processes that differentiate them from bacteria and eukaryotes

    • Investigate potential roles in archaeal-specific membrane architecture

    • Examine connections to methanogenesis, a metabolic pathway of significant evolutionary interest

  • Horizontal gene transfer assessment:

    • Analyze whether MJ1072 shows evidence of horizontal gene transfer between domains

    • Identify potential gene acquisition events that might have contributed to archaeal adaptation

Using the genetic system now available for M. jannaschii , researchers can conduct more sophisticated evolutionary studies directly in this model organism rather than relying solely on comparative genomics and heterologous expression.

What potential biotechnological applications might emerge from characterizing MJ1072?

The characterization of MJ1072 could lead to several biotechnological applications, particularly if it displays interesting thermostable properties:

  • Enzyme technology applications:

    • If MJ1072 proves to have enzymatic activity, its thermostability could make it valuable for industrial processes requiring high temperatures

    • Potential applications in biofuel production, bioremediation, or fine chemical synthesis

    • Template for protein engineering of thermostable biocatalysts

  • Thermostable protein design:

    • Identification of structural features contributing to MJ1072 thermostability could inform rational design of thermostable proteins

    • Development of general principles for adapting mesophilic proteins to high-temperature applications

  • Membrane technology:

    • If MJ1072 is confirmed to be membrane-associated, it could inspire designs for thermostable membrane proteins

    • Applications in high-temperature biosensors, filtration technologies, or artificial membrane systems

  • Extremozyme applications:

    • Use in PCR-related technologies if nucleic acid binding activity is identified

    • Potential applications in food processing, detergent formulations, or pharmaceutical manufacturing

  • Archaeal expression system development:

    • Knowledge gained about MJ1072 expression and regulation could contribute to developing M. jannaschii as a host for thermostable protein production

    • Creation of archaeal expression vectors incorporating MJ1072 regulatory elements

The intersection of basic research on archaeal proteins and applied biotechnology continues to yield valuable tools, particularly in the field of thermostable enzymes for industrial applications.

How might systems biology approaches advance our understanding of MJ1072's role in M. jannaschii?

Systems biology approaches can provide a holistic view of MJ1072's function within the broader context of M. jannaschii biology:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data to place MJ1072 within cellular networks

    • Generate condition-specific co-expression networks to identify functional modules containing MJ1072

    • Compare wild-type and MJ1072 knockout strains across multiple omics layers

  • Genome-scale metabolic modeling:

    • Incorporate MJ1072 into genome-scale metabolic models of M. jannaschii

    • Perform flux balance analysis to predict metabolic impacts of MJ1072 perturbation

    • Identify potential synthetic lethal interactions with other genes

  • Interactome mapping:

    • Generate comprehensive protein-protein interaction networks centered on MJ1072

    • Identify protein complexes containing MJ1072

    • Map genetic interactions through synthetic genetic arrays or CRISPRi screens

  • Environmental response networks:

    • Analyze how MJ1072 integration in cellular networks changes under different environmental conditions

    • Map stress response networks specific to thermophiles

    • Identify how MJ1072 contributes to cellular resilience under extreme conditions

  • Comparative systems biology:

    • Compare network position and importance of MJ1072 homologs across different archaeal species

    • Identify conserved modules and species-specific adaptations

    • Correlate network properties with environmental adaptations

These systems-level approaches can reveal emergent properties not apparent from reductionist studies and place MJ1072 within the broader context of archaeal physiology and adaptation to extreme environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.