Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1074 (MJ1074)

What is Methanocaldococcus jannaschii and why is it significant for research?

Methanocaldococcus jannaschii is a phylogenetically deeply rooted archaeon, representing one of the first known hyperthermophilic methanogens. Its significance stems from several key factors:

• It was the first archaeon to have its genome completely sequenced (1.66 megabase pair)

• It derives energy solely through hydrogenotrophic methanogenesis (4H₂ + CO₂ → CH₄ + 2H₂O), one of Earth's most ancient respiratory metabolisms

• It thrives in extreme conditions that mimic early Earth environments, growing at temperatures of 48-94°C (optimum ~85°C) and pressures up to more than 500 atm

• It represents a minimal requirement for life to exist independently, generating its entire cell from inorganic nutrients

The study of M. jannaschii provides valuable insights into early life evolution, ancient metabolic pathways, and adaptation to extreme environments.

What is currently known about the MJ1074 protein?

MJ1074 is classified as an uncharacterized protein from M. jannaschii with limited functional characterization. Current knowledge includes:

• UniProt accession number: Q58474

• Complete amino acid sequence: MAIAYAKLYELIHKKIKDEREADELYNAIIEIIKESKVIVKNELKDELKDELATKKDIDLVREEMKAMEERILRYVDNRFNQLLIVQLIILFAIIITNPNAIELIKLLFGFK

• It consists of 112 amino acids

• It is presumed to have a transmembrane domain based on sequence analysis, as indicated by the hydrophobic region near the C-terminus

Despite the completion of the M. jannaschii genome sequencing in 1996, approximately 60% of its genes, including MJ1074, still lack definitively assigned functions .

What expression systems are most suitable for producing recombinant M. jannaschii proteins?

For recombinant expression of M. jannaschii proteins including MJ1074, several systems have proven effective:

• E. coli with specialized plasmids: Using the bacteriophage T7 RNA polymerase-promoter system with plasmids like pET24b or pET15b

• Codon optimization: Employing E. coli host strains containing the ileX and argU genes (encoding tRNA AUA and tRNA AGA/AGG) on plasmids like pSJS1240 to overcome codon bias issues

• Native expression system: With the recent development of genetic tools for M. jannaschii, it's now possible to express tagged proteins directly in the native organism, allowing for purification of proteins with all archaeal-specific post-translational modifications

The choice depends on research goals. For structural studies requiring large quantities of protein, E. coli remains most practical. For studying native function with proper modifications, the recently developed genetic system for M. jannaschii offers advantages .

How can I design experiments to determine the function of MJ1074?

To determine the function of uncharacterized proteins like MJ1074, a multi-faceted approach is recommended:

• Comparative genomics analysis:

  • Identify conserved domains through PSI-BLAST searches

  • Analyze gene neighborhoods in related archaeal species

  • Examine phylogenetic distribution patterns

• Structural prediction and analysis:

  • Generate structural models using AlphaFold or similar tools

  • Identify potential active sites or binding pockets

  • Compare with structurally characterized proteins

• Gene knockout studies:

  • Utilize the newly developed genetic system for M. jannaschii to create a MJ1074 deletion strain

  • Assess phenotypic changes under various growth conditions

  • Perform comparative proteomic or transcriptomic analyses between wild-type and knockout strains

• Protein-protein interaction studies:

  • Express affinity-tagged MJ1074 in M. jannaschii (using methods described in source )

  • Perform pull-down assays followed by mass spectrometry to identify interaction partners

  • Validate interactions through reciprocal co-immunoprecipitation

• Biochemical characterization:

  • Test for common enzymatic activities based on structural predictions

  • Assess stability and activity at various temperatures (50-95°C)

  • Examine cofactor requirements and substrate specificity

What are the key considerations when expressing and purifying thermostable proteins like MJ1074?

Working with thermostable proteins from hyperthermophiles presents unique challenges and opportunities:

• Expression optimization:

  • Lower expression temperatures (25-30°C) often yield better folding despite the protein's thermophilic origin

  • Consider inclusion of archaeal chaperones for optimal folding

  • For difficult-to-express proteins, test cell-free systems with archaeal components

• Purification strategy:

  • Leverage thermal stability by incorporating a heat treatment step (70-80°C for 15-30 minutes) to eliminate most E. coli proteins

  • Consider affinity tags (His, FLAG, or Strep) for ease of purification; these can be incorporated using the genetic system described in

  • For membrane-associated proteins like MJ1074 (based on sequence analysis), test detergents effective at high temperatures (e.g., DDM, Triton X-100)

• Storage considerations:

  • Thermostable proteins often remain active when stored at 4°C for extended periods

  • For long-term storage, 50% glycerol solutions at -20°C are typically effective

  • Avoid repeated freeze-thaw cycles as noted in commercial recommendations

• Activity assays:

  • Design assays that function at high temperatures (70-85°C)

  • Account for buffer evaporation during high-temperature incubation

  • Include proper thermostable controls for comparative analysis

How can I use the genetic system for M. jannaschii to study MJ1074 in vivo?

The recently developed genetic system for M. jannaschii offers powerful approaches for in vivo studies of MJ1074:

• Generation of knockout strains:

  • Design DNA constructs with homologous regions flanking the MJ1074 gene

  • Create a deletion construct using PCR and cloning methods described in

  • Transform M. jannaschii using heat shock method rather than chemical transformation

  • Select transformants using mevinolin resistance (10-20 μM)

  • Verify gene deletion through PCR analysis of genomic DNA

• Protein tagging approach:

  • Design constructs to add 3xFLAG-twin Strep tags to MJ1074, following methods in

  • Place the modified gene under control of strong promoters (e.g., PflaB1B2)

  • Purify the tagged protein directly from M. jannaschii for functional studies

• Growth condition analysis:

  • Compare growth rates of wild-type and MJ1074 mutant strains under various conditions:

    • Different temperatures (50-90°C)

    • Varying hydrogen and CO₂ concentrations

    • Presence of potential stressors (sulfite, oxygen exposure, etc.)

  • Cultivation can be performed in liquid medium or on solid medium in anaerobic canisters at 80°C

• Complementation studies:

  • Re-introduce wild-type or mutated versions of MJ1074 into knockout strains

  • Assess rescue of phenotypes to confirm gene function

  • Test chimeric constructs to identify functional domains

What approaches can be used to determine the structure of MJ1074?

Several complementary approaches can be employed to determine the structure of MJ1074:

• X-ray crystallography:

  • Express and purify MJ1074 with a cleavable affinity tag

  • Screen various crystallization conditions optimized for small archaeal proteins

  • Consider lipid cubic phase crystallization if transmembrane regions are present

  • Take advantage of the protein's thermostability, which often enhances crystal packing

• Cryo-electron microscopy:

  • Particularly useful if MJ1074 forms larger complexes or has membrane associations

  • May require expression of MJ1074 with fusion partners to increase particle size

  • Consider reconstitution in nanodiscs if transmembrane regions are confirmed

• NMR spectroscopy:

  • Suitable for smaller proteins like MJ1074 (112 amino acids)

  • Express isotopically labeled protein (¹⁵N, ¹³C) in minimal media

  • Perform experiments at elevated temperatures (40-60°C) to mimic native conditions and improve spectral quality

• Predictive modeling:

  • Utilize AlphaFold2 or RoseTTAFold for initial structural predictions

  • Validate predictions through limited proteolysis experiments

  • Incorporate structural restraints from experimental data (e.g., disulfide mapping, SAXS)

How do I analyze potential interactions between MJ1074 and other M. jannaschii proteins?

To investigate protein-protein interactions involving MJ1074:

• Affinity purification-mass spectrometry:

  • Express MJ1074 with an affinity tag in M. jannaschii using the genetic system

  • Perform pull-downs under native conditions (high temperature, anaerobic)

  • Identify co-purifying proteins through mass spectrometry

  • Validate interactions through reciprocal pull-downs

• Bacterial/yeast two-hybrid systems adapted for archaeal proteins:

  • Modify existing two-hybrid systems to accommodate archaeal proteins

  • Screen against a library of M. jannaschii proteins

  • Validate positive interactions through co-immunoprecipitation

• Crosslinking mass spectrometry:

  • Perform in vivo crosslinking in M. jannaschii cultures

  • Isolate and analyze crosslinked complexes containing MJ1074

  • Map interaction interfaces through MS/MS analysis of crosslinked peptides

• Co-expression studies:

  • Identify genes co-regulated with MJ1074 through transcriptomic analysis

  • Test functional relationships through co-expression in heterologous systems

  • Assess physical interactions through co-purification experiments

What bioinformatic approaches can help predict the function of MJ1074?

Bioinformatic analyses can provide valuable insights into the potential function of MJ1074:

• Advanced sequence analysis:

  • Apply profile hidden Markov models (HMMs) to detect remote homologies

  • Analyze conserved residues across archaeal homologs

  • Examine co-evolution patterns within the protein family

• Genomic context analysis:

  • Examine the genomic neighborhood of MJ1074 in M. jannaschii

  • Compare with syntenic regions in related archaeal genomes

  • Look for conserved gene clusters that might indicate functional relationships

• Structural prediction and comparison:

  • Generate structural models using deep learning approaches

  • Compare predicted structures with known protein folds

  • Identify potential active sites or binding pockets

• Functional prediction algorithms:

  • Apply machine learning approaches trained on archaeal proteins

  • Use metagenomic functional annotation tools

  • Integrate predictions from multiple algorithms for consensus

What are common challenges in working with recombinant M. jannaschii proteins and how can I overcome them?

Researchers working with recombinant M. jannaschii proteins face several challenges:

• Expression difficulties:

  • Problem: Poor expression in heterologous systems

  • Solution: Optimize codon usage for the host organism; co-express archaeal tRNAs like ileX and argU in E. coli ; lower expression temperature; try archaeal cell-free expression systems

• Protein folding issues:

  • Problem: Misfolded proteins or inclusion bodies

  • Solution: Co-express archaeal chaperones; use specialty E. coli strains designed for difficult proteins; try fusion partners known to enhance solubility

• Stability concerns:

  • Problem: Protein degradation during purification

  • Solution: Perform purification at elevated temperatures to denature host proteases; add protease inhibitors; minimize time between cell lysis and heat treatment

• Activity assessment:

  • Problem: Difficulty establishing functional assays for uncharacterized proteins

  • Solution: Test multiple potential substrates; perform assays at physiologically relevant temperatures (70-85°C); consider enzymatic coupling assays if direct activity measurement is challenging

• Membrane protein handling:

  • Problem: Difficulties extracting and purifying potential membrane proteins like MJ1074

  • Solution: Screen multiple detergents; consider nanodiscs or amphipols for stabilization; use mild solubilization conditions

How should I design controls for experiments involving MJ1074?

Proper experimental controls are crucial when working with uncharacterized proteins:

• Expression controls:

  • Empty vector controls processed identically to MJ1074-expressing samples

  • Well-characterized archaeal proteins expressed under the same conditions

  • Variant with key predicted functional residues mutated

• Functional assay controls:

  • Heat-denatured MJ1074 to establish baseline activity

  • Reactions lacking specific substrates or cofactors

  • Known enzymes with related activities as positive controls

• Interaction study controls:

  • Unrelated tagged proteins to identify non-specific binding partners

  • Competition assays with untagged MJ1074 to confirm specificity

  • Negative controls using denatured proteins

• Genetic manipulation controls:

  • Wild-type M. jannaschii processed alongside mutant strains

  • Complementation with wild-type MJ1074 to verify phenotype restoration

  • Control knockouts of unrelated genes to distinguish specific effects

How can I integrate data from multiple approaches to determine MJ1074 function?

A comprehensive approach to functional determination requires integrating diverse data types:

• Create a functional hypothesis framework:

  • Begin with bioinformatic predictions and structural models

  • Narrow possibilities through literature review of similar archaeal proteins

  • Formulate testable hypotheses based on preliminary data

• Design a decision tree for experiments:

  • Start with broad functional category tests

  • Progressively narrow experimental focus based on results

  • Validate findings through orthogonal methods

• Data integration strategies:

  • Use Bayesian approaches to update function probability based on new evidence

  • Employ machine learning to identify patterns across experimental datasets

  • Cross-validate findings between in silico, in vitro, and in vivo experiments

• Collaborative integration:

  • Combine expertise from multiple fields (structural biology, biochemistry, genetics)

  • Use standardized data formats to facilitate comparison

  • Consider consortium approaches for particularly challenging proteins

The integration of multiple lines of evidence dramatically increases confidence in functional assignments for previously uncharacterized proteins like MJ1074.

How might studying MJ1074 contribute to our understanding of archaeal biology?

Research on MJ1074 has potential to advance several areas of archaeal biology:

• Evolutionary insights:

  • Understanding conserved archaeal proteins may reveal ancient cellular functions

  • Comparing homologs across the archaeal domain can illuminate evolutionary processes

  • Studying uncharacterized proteins helps complete our picture of minimal cellular requirements

• Archaeal-specific processes:

  • May reveal novel cellular mechanisms unique to archaea

  • Could identify archaeal adaptations to extreme environments

  • Might uncover previously unknown metabolic pathways in methanogens

• Biotechnological applications:

  • Understanding thermostable proteins can lead to novel industrial enzymes

  • Archaeal proteins often possess unique properties valuable for biotechnology

  • Research on methanogens informs biofuel and biomethane production technologies

What emerging technologies might accelerate research on proteins like MJ1074?

Several cutting-edge approaches show promise for accelerating research on uncharacterized archaeal proteins:

• Advanced structural methods:

  • Cryo-electron tomography for visualizing proteins in cellular context

  • Microcrystal electron diffraction for challenging-to-crystallize proteins

  • Serial femtosecond crystallography using X-ray free electron lasers

• High-throughput functional screening:

  • Activity-based protein profiling for enzyme function discovery

  • Droplet microfluidics for massively parallel activity assays

  • Deep mutational scanning to map sequence-function relationships

• Computational advances:

  • AI-powered function prediction models

  • Molecular dynamics simulations at extended timescales

  • Quantum mechanical modeling of potential catalytic mechanisms

• Genetic system enhancements:

  • Further refinement of M. jannaschii genetic tools for CRISPR-based applications

  • Development of regulated expression systems for essential genes

  • Creation of archaeal synthetic biology platforms

By incorporating these emerging technologies, researchers can accelerate the functional characterization of MJ1074 and similar uncharacterized archaeal proteins.