Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1080 (MJ1080)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a particular tag, please specify it in your order; we will prioritize fulfilling your request.
Synonyms
MJ1080; Uncharacterized protein MJ1080
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-135
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1080
Target Protein Sequence
MEGKIMNIKHKIPILLLVLYIALGVFIQYNGISEFKSLPSPIYGGDYYYQMGVIWHIRDG GNPLESSSMIGGMPGYLPLYAYLCAKFCDLLNLDTMKGILYFSVVLFIMTSVIWFYLFRV LFKDDWVALIEVVLA
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1080

STRING: 243232.MJ_1080

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Intermediate Research Questions

  • How can homology-based approaches help predict MJ1080 function?
    Homology-based function prediction for MJ1080 involves several complementary methodologies:

    1. Sequence-based homology searches:

      • BLAST searches against characterized proteins in UniProt and NCBI databases

      • HMM-based searches using tools like HMMER against protein family databases (Pfam, InterPro)

      • Identification of conserved domains and motifs using CDD or PROSITE

    2. Structural homology modeling:

      • Using tools like I-TASSER, Phyre2, or AlphaFold2 to predict 3D structure

      • Structure-based function prediction through comparison with solved structures

    3. Phylogenetic analysis:

      • Construction of phylogenetic trees with homologous proteins

      • Analysis of evolutionary conservation patterns
        The patent WO1998007830A2 describes approaches for assigning functions to M. jannaschii ORFs including MJ1080. Specifically, it mentions isolating nucleic acid molecules with at least 90% sequence identity to M. jannaschii ORFs and expressing them in recombinant vectors for functional characterization. This would involve creating variants with different degrees of sequence similarity (95%, 96%, 97%, 98%, or 99%) to understand structure-function relationships .
        When performing these analyses, it's crucial to remember that archaeal proteins often have unique structural and functional features that may not be readily apparent through comparison with bacterial or eukaryotic homologs.

  • What approaches can be used to study protein-protein interactions involving MJ1080?
    Several methodologies can be employed to investigate protein-protein interactions of MJ1080:

    1. Co-immunoprecipitation (Co-IP):

      • Using antibodies against MJ1080 or its affinity tag to pull down interaction partners

      • Mass spectrometry identification of co-precipitated proteins

    2. Yeast two-hybrid (Y2H) screening:

      • Creating fusion constructs with MJ1080 as bait

      • Screening against M. jannaschii genomic libraries

    3. Proximity-based labeling:

      • Fusing MJ1080 to enzymes like BioID or APEX2

      • Identifying proteins in close proximity through biotinylation

    4. Crosslinking coupled with mass spectrometry (XL-MS):

      • Chemical crosslinking of interacting proteins

      • MS identification of crosslinked peptides

    5. Surface plasmon resonance (SPR) or biolayer interferometry (BLI):

      • For validating and characterizing specific interactions

      • Determining binding kinetics and affinity
        When analyzing data from BioPlex 2.0 database or similar AP-MS experiments, researchers should employ statistical methods to distinguish true interactions from background . For thermophilic proteins like MJ1080, interaction studies may need to be conducted at elevated temperatures to capture physiologically relevant interactions.

  • What mass spectrometry approaches are most effective for MJ1080 characterization?
    Mass spectrometry offers powerful tools for characterizing MJ1080, with several specialized approaches particularly suited for this archaeal protein:

    1. Bottom-up proteomics workflow:

      • Enzymatic digestion (typically trypsin) of MJ1080

      • LC-MS/MS analysis of resulting peptides

      • Database searching against M. jannaschii proteome

    2. Top-down proteomics:

      • Analysis of intact MJ1080 protein

      • Characterization of proteoforms and post-translational modifications

    3. Advanced fragmentation techniques:

      • Electron transfer dissociation (ETD) for preserving labile modifications

      • Ultraviolet photodissociation (UVPD) at 213 nm for comprehensive sequence coverage

      • Higher-energy collisional dissociation (HCD) for improved fragment ion detection

    4. Ion mobility-mass spectrometry:

      • Tandem-trapped ion mobility spectrometry/mass spectrometry (tTIMS/MS)

      • Structural characterization of protein conformations
        For data analysis, employ database searching algorithms tailored for archaeal proteins, considering the unique amino acid compositions and modifications found in thermophilic archaea. Recent multi-laboratory intercomparison studies suggest that pairwise regressions of spectral counts between laboratories should yield R² values averaging 0.62±0.11 for reliable quantification, and Sørensen similarity analysis of the top proteins should reveal 70-80% similarity between laboratory groups .

Advanced Research Questions

  • How can I establish a genetic system to study MJ1080 function in vivo?
    Recent advances have made genetic manipulation of M. jannaschii possible. To study MJ1080 function in vivo, implement the following methodological approach:

    1. Construction of suicide plasmid vectors:

      • Design a vector based on pBluescript II SK(+) containing:

        • Upstream and downstream regions flanking MJ1080 for homologous recombination

        • Selectable marker (e.g., mevinolin resistance)

        • Desired modifications (knockout, affinity tag, promoter replacement)

    2. Transformation protocol:

      • Grow M. jannaschii at 65°C (rather than optimal 85°C) to increase membrane permeability

      • Apply heat shock for transformation (simpler than PEG/liposome methods used for other methanogens)

      • Use linearized DNA to promote double crossover events and avoid merodiploid formation

    3. Selection and verification:

      • Select transformants on solid medium with appropriate antibiotics (colonies form in 3-4 days)

      • Verify genome modifications by PCR

    4. Functional analysis options:

      • Gene knockout to observe phenotypic effects

      • Affinity tagging for protein isolation and interaction studies

      • Promoter replacement for controlled expression
        For tagging MJ1080, consider using a 3xFLAG-twin Strep tag as successfully demonstrated with other M. jannaschii proteins. When designing experiments, account for M. jannaschii's fast growth rate (generation time of 26 minutes at 85°C) compared to other methanogens (M. maripaludis: 2 hours, M. acetivorans: 8.5 hours) .

  • What bioinformatic approaches can predict structure-function relationships in MJ1080?
    Advanced bioinformatic analysis of MJ1080 requires an integrated computational approach:

    1. Transmembrane topology prediction:

      • Use specialized tools (TMHMM, Phobius, TOPCONS) to predict membrane-spanning regions

      • The amino acid sequence suggests MJ1080 likely contains membrane-spanning domains

    2. Secondary structure prediction:

      • Apply tools like PSIPRED, JPred, and SPIDER3 for secondary structure elements

      • Compare predictions from multiple algorithms for consensus

    3. Tertiary structure modeling:

      • Implement AlphaFold2 or RoseTTAFold for de novo structure prediction

      • Validate models using MolProbity, PROCHECK, and VERIFY3D

    4. Functional site prediction:

      • Search for binding pockets using CASTp, LIGSITE, or COACH

      • Identify potential catalytic residues through ConSurf and catalytic site atlas

    5. Molecular dynamics simulations:

      • Simulate protein behavior at high temperatures (85°C) characteristic of M. jannaschii

      • Analyze stability, conformational changes, and potential interaction sites

    6. Evolutionary analysis:

      • Apply rate4site to identify functionally important residues

      • Compare with other archaeal homologs to determine conserved regions
        Due to the extremophilic nature of M. jannaschii, standard bioinformatic tools may require parameter adjustments. For example, amino acid composition bias toward thermostability (increased charged residues, fewer thermolabile residues) should be considered when interpreting prediction results .

  • How can I design experiments to determine the physiological role of MJ1080 in M. jannaschii metabolism?
    To elucidate MJ1080's physiological role, implement a multi-faceted experimental design:

    1. Gene expression analysis under various conditions:

      • Cultivate M. jannaschii under different stressors (temperature, pressure, nutrient limitation)

      • Analyze MJ1080 expression using RT-qPCR or RNA-seq

      • Identify conditions that up/down-regulate MJ1080 expression

    2. Knockout phenotype characterization:

      • Generate MJ1080 deletion strain using the genetic system described

      • Compare growth rates, metabolic profiles, and stress responses to wild-type

      • Measure methanogenesis efficiency (4H₂ + CO₂ → CH₄ + 2H₂O) in knockout vs. wild-type

    3. Subcellular localization:

      • Construct GFP or other thermostable fluorescent protein fusions

      • Visualize localization using advanced microscopy techniques adapted for thermophiles

    4. Metabolomic analysis:

      • Compare metabolic profiles of wild-type and MJ1080 knockout strains

      • Identify metabolic pathways affected by MJ1080 absence

    5. Interactome mapping:

      • Affinity purification of tagged MJ1080 followed by mass spectrometry

      • Construct protein-protein interaction networks to place MJ1080 in cellular context

    6. Complementation studies:

      • Reintroduce wild-type and mutant variants of MJ1080 into knockout strain

      • Identify critical residues for function through site-directed mutagenesis
        When designing these experiments, consider that M. jannaschii cultivation requires specialized equipment for high-temperature, high-pressure growth conditions. The optimized growth conditions include 48-94°C temperature range and pressures mimicking deep-sea hydrothermal vents (approximately 250 atmospheres) .

  • What approaches can integrate multi-omics data to understand MJ1080 in the context of M. jannaschii's adaption to extreme environments?
    Integrating multi-omics data requires sophisticated computational approaches:

    1. Data collection protocols:

      • Genomics: Whole genome sequencing with coverage >30x

      • Transcriptomics: RNA-seq under various environmental conditions

      • Proteomics: Quantitative mass spectrometry (e.g., TMT labeling)

      • Metabolomics: Untargeted LC-MS and GC-MS approaches

    2. Data integration frameworks:

      • Network-based approaches connecting different omics layers

      • Correlation-based methods identifying relationships between datasets

      • Machine learning algorithms for pattern recognition across datasets

    3. Analytical pipeline:

      • Pre-processing: Normalization and quality control specific to each data type

      • Integration: Joint analysis of multiple data types using multivariate methods

      • Interpretation: Pathway and enrichment analysis incorporating extremophile-specific knowledge

    4. Visualization tools:

      • Cytoscape for network visualization and analysis

      • R-based tools (ggplot2, Complexheatmap) for multi-omics data representation

      • Custom visualizations for M. jannaschii's metabolic pathways
        When analyzing data, recent advancements in computational proteomics should be leveraged. As documented in recent metaproteomic intercomparison studies, employing multiple software packages can maximize protein identification rates. The common bioinformatic pipeline used by seven laboratories successfully identified a shared set of 1056 proteins from 1395 shared peptide constituents, demonstrating the reproducibility potential in archaeal proteomics studies . For uncharacterized proteins like MJ1080, combining phylogenetic profiling, co-expression analysis, and functional enrichment across multiple omics layers can reveal potential roles in adaptation to extreme environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.