Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1089 (MJ1089)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant MJ1089 (UniProt ID: Q58489) is a 268-amino-acid protein produced in Escherichia coli with an N-terminal His tag for purification . The protein is derived from M. jannaschii, a deep-sea hydrothermal vent archaeon known for its resilience to extreme temperatures (85°C optimum) and high-pressure environments . Despite its uncharacterized function, MJ1089 is available as a research reagent for biochemical and structural analyses .

Source Organism

M. jannaschii is a model archaeon for studying extremophilic biology and early Earth metabolism . Its genome was the first archaeal genome sequenced, revealing unique adaptations to high-temperature hydrogenotrophic methanogenesis (CO₂ + 4H₂ → CH₄ + 2H₂O) . The organism’s proteins, including MJ1089, are valued for their stability under harsh conditions, making them candidates for industrial biocatalysis and structural biology .

Genetic and Biotechnological Tools

Recent advancements in M. jannaschii genetic systems (e.g., gene knockout methods and affinity-tagging protocols) have enabled targeted studies of its proteins . While MJ1089 itself has not been functionally characterized, these tools could facilitate future investigations into its role.

Unresolved Questions and Research Potential

  • Functional Role: MJ1089 is annotated as an "uncharacterized protein," with no confirmed involvement in metabolic pathways or protein interactions . Homologs in other archaea may provide clues.

  • Structural Studies: No structural data (e.g., X-ray crystallography or NMR) are currently available for MJ1089. Comparative analysis with proteins like MJ1099—a TIM-barrel enzyme involved in cofactor biosynthesis—could inform hypotheses .

  • Applications: Its thermostability may make MJ1089 useful in enzyme engineering or as a scaffold for synthetic biology .

Handling and Stability

  • Storage: Repeated freeze-thaw cycles degrade the protein; single-use aliquots are recommended .

  • Reconstitution: Centrifugation before reconstitution ensures complete dissolution. Glycerol addition enhances stability for long-term storage .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its inclusion during development.
Synonyms
MJ1089; Uncharacterized protein MJ1089
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1089
Target Protein Sequence
MGFMKHNIVDNVAFSNKLRHVNPKLKVIFALSLLLISVFSTSFIVPLIIFFINSILLLFK AKVPKKIYAVFVGIPLGFGILNLVIFAFLFGTVEWFKINVFGFEIPVYKDGIELGLLLFG RMLGGVSSMLFLAFTTPMVELFYIFRELKMPDVLVDMMMLIYRYIFVLYEEYEKMKFAQE SRLGTSNLKSTYKSLGALAAHLFIRAWEKGEKLNITMMSRCYDGKIKLLQTIENPSIKYI LFIAIFDIFLIILAYLTKDFTLTSYIKI
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1089

STRING: 243232.MJ_1089

Protein Families
CbiQ family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MJ1089 and what organism does it come from?

MJ1089 is an uncharacterized protein encoded by the MJ1089 gene in Methanocaldococcus jannaschii, a thermophilic methanogenic archaeon belonging to the domain Archaea, kingdom Methanobacteriati, and phylum Methanobacteriota . M. jannaschii was isolated from a submarine hydrothermal vent at the East Pacific Rise, at a depth of 2600 meters near the western coast of Mexico, where it inhabits "white smoker" chimneys in extreme conditions with temperatures ranging from 48-94°C .

How is recombinant MJ1089 typically expressed and purified?

Recombinant MJ1089 is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The following table outlines the key parameters for expression and purification:

ParameterDetails
Expression SystemE. coli
Fusion TagN-terminal His-tag
Protein LengthFull Length (1-268 amino acids)
FormLyophilized powder
Purity>90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

For purification, affinity chromatography using nickel columns is typically employed to isolate the His-tagged protein. Following purification, the protein is often lyophilized to improve stability during storage. When designing expression studies, researchers should consider that proteins from thermophilic organisms may require optimization of expression conditions in mesophilic hosts like E. coli to achieve proper folding and solubility.

What are the recommended storage conditions for recombinant MJ1089?

Based on available information, the following storage recommendations should be followed to maintain protein stability and activity:

  • Store lyophilized protein at -20°C/-80°C upon receipt .

  • After reconstitution, store working aliquots at 4°C for up to one week .

  • For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% (50% is recommended) and store in aliquots at -20°C/-80°C .

  • Avoid repeated freeze-thaw cycles as they can lead to protein denaturation and loss of activity .

For reconstitution, it is recommended to briefly centrifuge the vial before opening to bring the contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What experimental applications require recombinant MJ1089?

Recombinant MJ1089 can be utilized in various experimental applications, particularly those focused on understanding extremophile biology and archaeal membrane proteins. Key applications include:

  • Structural studies: X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy to determine three-dimensional structure.

  • Functional characterization: Biochemical assays to determine potential enzymatic activities or binding partners.

  • Comparative genomics: Analyzing sequence conservation across archaeal species to infer potential functions.

  • Extremophile adaptation studies: Investigating how proteins from thermophilic organisms maintain stability and function under extreme conditions.

  • Membrane biology research: If MJ1089 is confirmed as a membrane protein, it may serve as a model for understanding archaeal membrane architecture.

When designing experiments, researchers should consider the native extreme environment of M. jannaschii and how those conditions might affect protein behavior in vitro.

What potential functions might MJ1089 have based on sequence and structural analysis?

Although MJ1089 is classified as an uncharacterized protein, sequence analysis suggests it may be a membrane-associated protein. The abundance of hydrophobic residues and potential transmembrane domains supports this hypothesis.

Researchers can employ several bioinformatic approaches to predict potential functions:

  • Homology-based predictions: Searching for distant homologs using position-specific scoring matrices or hidden Markov models.

  • Structural predictions: Using tools like AlphaFold or RoseTTAFold to generate structure predictions, which may reveal functional domains.

  • Conserved domain analysis: Identifying conserved motifs that might indicate specific functions.

  • Genomic context analysis: Examining neighboring genes in the M. jannaschii genome to identify potential functional relationships.

M. jannaschii is known to possess many unique proteins involved in methanogenesis and adaptation to extreme environments. MJ1089 could potentially play a role in membrane stability under extreme conditions, transport processes, or energy metabolism. For robust functional predictions, researchers should combine computational approaches with experimental validation.

How can researchers overcome challenges in functional characterization of archaeal uncharacterized proteins like MJ1089?

Functional characterization of archaeal proteins presents unique challenges due to phylogenetic distance from well-studied organisms and the extreme environments these microbes inhabit. Researchers can employ several strategies to overcome these challenges:

  • Heterologous expression optimization:

    • Use specialized E. coli strains designed for expressing proteins from AT-rich genomes

    • Co-express archaeal chaperones to assist proper folding

    • Optimize codons for the expression host

    • Consider archaeal expression systems for proteins that fail to express properly in bacteria

  • Activity assays under extremophile conditions:

    • Perform biochemical assays at high temperatures (48-94°C) to match native conditions

    • Include pressure chambers for simulating deep-sea environments

    • Use buffers that maintain stability at high temperatures

  • Protein-protein interaction studies:

    • Yeast two-hybrid adaptations for thermophilic proteins

    • Pull-down assays using M. jannaschii lysates

    • Chemical cross-linking followed by mass spectrometry

  • Gene knockout/knockdown studies:

    • If genetic systems exist for M. jannaschii, create targeted deletions

    • Analyze phenotypic changes to infer function

The comprehensive genome of M. jannaschii has revealed many genes with unique functions in archaea, and several archaeal-specific metabolic pathways have been worked out biochemically in this organism . Similar approaches could be applied to characterize MJ1089.

What role might MJ1089 play in extremophile adaptation?

M. jannaschii thrives in environments with temperatures from 48-94°C, high pressure (2600m depth), and moderate salinity . Uncharacterized proteins like MJ1089 may contribute to this remarkable adaptation through several potential mechanisms:

  • Membrane stability: If MJ1089 is indeed a membrane protein, it may contribute to maintaining membrane fluidity and integrity under extreme conditions. Archaeal membranes differ fundamentally from bacterial and eukaryotic membranes, often containing ether-linked lipids rather than ester-linked phospholipids, which provide greater stability at high temperatures.

  • Protein thermostability mechanisms:

    • Higher proportion of charged amino acids forming salt bridges

    • Increased hydrophobic interactions in the protein core

    • Reduced number of thermolabile amino acids

    • More compact protein folding

  • Pressure adaptation: Proteins from deep-sea organisms often show structural adaptations that maintain function under high hydrostatic pressure, such as smaller void volumes and altered subunit interactions.

Experimental approaches to investigate MJ1089's role in extremophile adaptation could include comparative analysis with homologs from non-extremophile archaea and examining protein stability and function across a range of temperatures and pressures.

How does the genetic context of MJ1089 inform potential functional pathways?

Analyzing the genomic neighborhood of MJ1089 in the M. jannaschii genome can provide valuable insights into its potential functional pathways. This approach, known as genomic context analysis, relies on the principle that functionally related genes are often co-located or co-transcribed.

Researchers should examine:

  • Gene clusters: Identify if MJ1089 is part of an operon or gene cluster, which might suggest involvement in a common pathway.

  • Conserved gene neighborhoods: Compare the genomic context of MJ1089 with related archaea to identify conserved gene arrangements.

  • Transcriptomic correlations: Analyze if MJ1089 is co-expressed with genes of known function under specific conditions.

M. jannaschii possesses many unique metabolic pathways, including those for methanogenesis and adaptation to extreme environments. The genome includes numerous hydrogenases and enzymes involved in novel amino acid synthesis pathways . If MJ1089 is genomically associated with any of these pathways, it may provide clues to its function.

What techniques can be employed to study potential inteins in MJ1089?

M. jannaschii has been found to contain a large number of inteins, with 19 discovered in one study . Inteins are protein segments that excise themselves post-translationally and splice the flanking segments (exteins) together. If MJ1089 contains inteins, the following methodologies would be useful for their study:

  • Sequence analysis for intein motifs:

    • Search for conserved intein splicing motifs (N-terminal C-extein junction and C-terminal C-extein junction)

    • Use databases like InBase to identify potential intein regions

  • Protein splicing verification:

    • Express recombinant protein and analyze by SDS-PAGE and mass spectrometry to detect splicing products

    • Time-course analysis to monitor splicing kinetics

  • Functional impact assessment:

    • Compare properties of the precursor protein versus the spliced product

    • Investigate if splicing is regulated under specific conditions

  • Intein engineering applications:

    • Develop protein purification systems using controllable intein splicing

    • Create protein cyclization tools

    • Design split-intein systems for protein trans-splicing

A methodological workflow for intein investigation would typically involve:

  • Bioinformatic prediction of intein regions

  • Recombinant expression with and without the predicted intein

  • Biochemical characterization of splicing efficiency

  • Structural analysis of the intein domain

  • Functional comparison of precursor and spliced forms

What are the optimal expression conditions for obtaining functional recombinant MJ1089?

Expressing proteins from thermophilic archaea in mesophilic hosts presents unique challenges. The following methodological approaches can help optimize expression of functional recombinant MJ1089:

  • Expression system selection:

    • Standard E. coli strains: BL21(DE3), Rosetta, or Arctic Express (for cold-adapted expression)

    • Consider archaeal expression hosts for authentic post-translational modifications

  • Expression vector design:

    • Include an N-terminal His-tag as documented for successful expression

    • Consider testing multiple fusion tags (SUMO, MBP, GST) if solubility is an issue

    • Codon optimization for the expression host

  • Expression conditions optimization:

ParameterStandard ConditionsAlternative Conditions
Temperature37°C16-30°C for improved folding
Induction0.5-1.0 mM IPTGAuto-induction media
Duration3-4 hoursOvernight for lower temperatures
MediaLBTB or 2XYT for higher yield
AdditivesNone5-10% glycerol, osmolytes
  • Solubility enhancement strategies:

    • Co-expression with archaeal chaperones

    • Addition of detergents for membrane proteins

    • Refolding from inclusion bodies if necessary

  • Purification approach:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Size exclusion chromatography for further purification

    • Consider on-column refolding protocols if needed

When expressing proteins from extremophiles, it's important to remember that optimal folding conditions in the lab may differ significantly from the native environment. Multiple expression strategies should be tested systematically to identify conditions that yield properly folded, functional protein.

How can researchers assess the membrane association properties of MJ1089?

Given the hydrophobic nature of the MJ1089 amino acid sequence, it may be a membrane-associated protein. The following methodological approaches can help characterize its membrane properties:

  • Computational prediction:

    • Transmembrane domain prediction using tools like TMHMM, Phobius, or TOPCONS

    • Hydropathy plot analysis

    • Signal peptide identification

  • Experimental verification of membrane association:

    • Membrane fractionation of native M. jannaschii or recombinant expression systems

    • Membrane flotation assays

    • Protease protection assays

    • Chemical labeling of exposed residues

  • Topology determination:

    • Cysteine scanning mutagenesis

    • Fluorescence protease protection assays

    • Glycosylation mapping

    • GFP fusion reporter systems

  • Lipid interaction studies:

    • Liposome binding assays

    • Differential scanning calorimetry

    • Monolayer insertion experiments

    • Lipid-specific crosslinking

  • Structural studies specific to membrane proteins:

    • Detergent screening for solubilization

    • Lipid nanodiscs or bicelles for native-like environment

    • Cryo-electron microscopy of membrane-embedded protein

When designing experiments to study potential membrane proteins from extremophiles, researchers should consider the unique composition of archaeal membranes, which often contain ether-linked lipids rather than ester-linked phospholipids found in bacteria and eukaryotes. Using archaeal lipid extracts or synthetic archaeal lipids may provide a more native-like environment for functional studies.

What structural biology techniques are most suitable for studying MJ1089?

Determining the structure of MJ1089 would provide valuable insights into its function. The following structural biology approaches are recommended, with considerations for the challenges posed by an uncharacterized archaeal protein:

  • X-ray crystallography:

    • Requires production of diffraction-quality crystals

    • Screening multiple constructs with various truncations

    • Surface entropy reduction mutations to promote crystallization

    • If MJ1089 is a membrane protein, consider lipidic cubic phase crystallization

  • Cryo-electron microscopy (cryo-EM):

    • Particularly valuable for membrane proteins

    • No crystallization required

    • May require larger complexes for accurate particle picking

    • Consider using antibody fragments to increase particle size

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Suitable for smaller proteins or domains (typically <30 kDa)

    • Requires isotopic labeling (15N, 13C, 2H)

    • Can provide dynamic information

    • Challenging for membrane proteins unless detergent-solubilized

  • Small-angle X-ray scattering (SAXS):

    • Provides low-resolution envelope of protein shape

    • Works in solution without crystallization

    • Can complement other structural methods

    • Useful for examining conformational changes

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Provides information on protein dynamics and solvent accessibility

    • Can identify regions involved in binding interactions

    • Does not require crystallization

    • Compatible with membrane proteins in detergent

Given that MJ1089 is from a thermophilic organism, structural studies might benefit from data collection at elevated temperatures that mimic the native environment. Additionally, considering the hyperthermophilic nature of M. jannaschii, MJ1089 may exhibit enhanced stability which could be advantageous for structural studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.