Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1107 (MJ1107)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Full Length Methanocaldococcus jannaschii Uncharacterized Protein MJ1107(MJ1107) is a protein that is expressed in E. coli and fused to an N-terminal His tag . The protein's source organism is Methanocaldococcus jannaschii . The gene name is MJ1107, with synonyms including MJ1107 and Uncharacterized protein MJ1107 . The UniProt ID is Q58507 .

Properties

PropertyValue
Cat.No.RFL9759MF
SpeciesMethanocaldococcus jannaschii
SourceE. coli
TagHis
Protein LengthFull Length (1-149)
FormLyophilized powder
AA SequenceMKFFVVFVMAVAYSKLYELIKNVKDEKEAEELCKIIEEFFEKQCKENVSKKFEEQKPVLKLELKEELRKELTTKEDLELIGEKILRYVDNKINQVIEKINQLDKKIDEGFYQLDKKVDTLKRDIIIIALIIILANYAPSIIGKILSFLK
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended .

Biological Context

Methanocaldococcus jannaschii is a hyperthermophilic methanogen . Genetic tools have been developed to explore its biology, including a genetic system based on homologous recombination . M. jannaschii has been the subject of research yielding significant breakthroughs .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
MJ1107; Uncharacterized protein MJ1107
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1107
Target Protein Sequence
MKFFVVFVMAVAYSKLYELIKNVKDEKEAEELCKIIEEFFEKQCKENVSKKFEEQKPVLK LELKEELRKELTTKEDLELIGEKILRYVDNKINQVIEKINQLDKKIDEGFYQLDKKVDTL KRDIIIIALIIILANYAPSIIGKILSFLK
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1107

STRING: 243232.MJ_1107

Protein Families
M.jannaschii MJ0023/MJ0349/MJ1072/MJ1074/MJ1107/MJECL16 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant in protein research?

Methanocaldococcus jannaschii is an autotrophic hyperthermophilic obligate anaerobic methanogen from the domain Archaea. Its significance stems from being the first archaeal organism to have its complete genome sequenced in 1996, providing a foundation for comparative genomics across domains of life . M. jannaschii thrives in extreme conditions, capable of growing at pressures exceeding 200 atmospheres and temperatures up to 94°C, classifying it as an extremophile . This organism's proteins, including uncharacterized ones like MJ1107, offer valuable insights into protein stability and function under extreme conditions, making them important subjects for structural biology and enzymology research.

What does the designation "uncharacterized protein" mean for MJ1107?

The term "uncharacterized protein" indicates that while the MJ1107 gene has been identified within the M. jannaschii genome, its biological function, structure, and biochemical properties remain largely unknown. Despite advances in genome annotation, more than one-third of M. jannaschii's genome remains functionally uncharacterized . Uncharacterized proteins represent significant research opportunities, as they may possess novel functions or structural properties. All functional assignments for such proteins should be considered testable predictions until experimental confirmation is obtained .

What expression systems are most effective for recombinant production of M. jannaschii proteins?

Several expression systems can be employed for recombinant production of M. jannaschii proteins, with selection dependent on research objectives:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, ease of genetic manipulation, rapid growthMay not properly fold hyperthermophilic proteins, lacks post-translational modificationsInitial characterization, high-throughput screening
Homologous expression in M. jannaschiiNative folding, authentic post-translational modificationsTechnical complexity, lower yields, requires specialized equipment for growth at high temperatures and pressuresFunctional studies requiring authentic protein structure
Cell-free systemsAvoids toxicity issues, allows for incorporation of non-canonical amino acidsLower yields, higher costDifficult-to-express proteins, structural studies

For M. jannaschii proteins, the development of genetic systems using mevinolin/simvastatin resistance markers has enabled homologous expression, though this approach requires specialized expertise . When designing expression constructs, consider using affinity tags such as the 3xFLAG-twin Strep tag to facilitate purification, as demonstrated for other M. jannaschii proteins .

How should experimental design address the challenges of working with hyperthermophilic archaeal proteins?

When designing experiments for hyperthermophilic archaeal proteins like MJ1107, researchers must carefully consider:

  • Temperature stability: All buffers and equipment must accommodate the high temperatures (80-95°C) at which these proteins typically function optimally.

  • Statistical considerations: Experimental design must account for appropriate replication to ensure statistical validity. As emphasized in research methodology literature, proper experimental design requires understanding the appropriate units to replicate and should include blocking variables when necessary .

  • Control selection: Include thermostable enzyme controls alongside MJ1107 to validate assay conditions.

  • Assay development: Standard enzyme assays may require modification for high temperature compatibility. Consider using paired t-tests for analyzing temperature-dependent activity variations to account for sample variability .

  • Oxygen sensitivity: Many archaeal proteins from methanogens are oxygen-sensitive. Techniques like those developed for FprA protein characterization can be adapted, as these methodologies allow handling under air while preserving enzymatic activity .

What bioinformatic strategies can predict potential functions of MJ1107?

A multi-tiered bioinformatic approach is recommended for predicting potential functions of uncharacterized proteins like MJ1107:

  • Sequence-based analysis:

    • Homology searches using PSI-BLAST against multiple databases

    • Protein family assignment using Pfam, InterPro, and COG databases

    • Conserved domain identification using CDD

  • Structural prediction:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • Structural alignment against PDB entries

    • Active site prediction based on structural motifs

  • Genomic context analysis:

    • Examination of operon structure (MJ1107 may be part of a monocistronic or polycistronic mRNA)

    • Phylogenetic profiling to identify co-occurrence patterns

    • Metabolic pathway reconstruction using resources like MjCyc

The successful application of such approaches is demonstrated in the recent reannotation of M. jannaschii, which resulted in 652 function assignments with enzyme roles, representing approximately one-third of the total protein-coding entries .

What experimental techniques are recommended for initial characterization of MJ1107?

For initial characterization of an uncharacterized protein like MJ1107, a systematic approach combining multiple techniques is recommended:

TechniquePurposeKey Considerations
Recombinant expression & purificationObtain pure protein for downstream analysesSelect expression system based on protein properties; consider adding affinity tags
SDS-PAGE & Western blottingConfirm protein size and expressionInclude appropriate size markers and controls
Mass spectrometryVerify protein identity, detect modificationsConsider potential archaeal-specific modifications
Circular dichroismAssess secondary structure and thermal stabilityPerform scans at varying temperatures (25-95°C)
Differential scanning calorimetryDetermine thermal denaturation profileCompare with mesophilic homologs if available
Activity screeningIdentify potential biochemical functionsTest for activities suggested by bioinformatic analysis using high-temperature compatible assays

How can structural studies of MJ1107 be optimized for a hyperthermophilic protein?

Structural studies of hyperthermophilic proteins like MJ1107 require specialized approaches:

  • Crystallization strategies:

    • Screen conditions at both room temperature and elevated temperatures (40-60°C)

    • Include osmolytes or stabilizing agents known to work with thermophilic proteins

    • Consider in situ crystallization methods that mimic native conditions

  • NMR spectroscopy:

    • Perform experiments at elevated temperatures to capture native conformational dynamics

    • Consider deuteration to improve spectral quality for this archaeal protein

    • Employ TROSY techniques for better resolution

  • Cryo-EM considerations:

    • Test multiple vitrification conditions as thermophilic proteins may behave differently during freezing

    • Consider collecting data at various temperatures to capture conformational states

  • Analysis frameworks:

    • Compare structural features with mesophilic homologs to identify thermostability determinants

    • Analyze ion-pair networks and hydrophobic interactions that may contribute to thermostability

    • Apply molecular dynamics simulations at elevated temperatures to predict conformational behavior

The lessons learned from structural studies of other M. jannaschii proteins, such as the FprA protein (which contains FMN and a binuclear iron center), can provide valuable insights for MJ1107 characterization .

How can genetic systems for M. jannaschii be utilized to study MJ1107 in vivo?

Recent developments in genetic manipulation of M. jannaschii provide opportunities for in vivo studies of MJ1107:

  • Transformation system: Utilize the established mevinolin/simvastatin-based selection system for M. jannaschii . This system has been successfully used to create strains like M. jannaschii BM10 and BM31 through double recombination processes.

  • Expression control: Engineer strains with modified promoters to control MJ1107 expression levels. The P<sub>sla-hmgA</sub> cassette has been effectively used to replace gene coding regions in M. jannaschii .

  • Tagging strategies: Consider integrating affinity tags such as 3xFLAG-twin Strep tag at the genomic level to study native MJ1107, as demonstrated for the FprA protein .

  • Functional validation: Design knockout or complementation studies using suicide plasmids similar to pDS261, which have been successfully employed for other M. jannaschii proteins .

  • Growth conditions: When conducting in vivo studies, maintain strict anaerobic conditions and high temperature (85-95°C) growth environments to ensure physiologically relevant observations.

Implementation of these genetic approaches requires specialized equipment and expertise for handling extremophilic archaea but offers invaluable insights into protein function within its native cellular context.

How should researchers interpret potential functional assignments for MJ1107 in the absence of direct experimental evidence?

When interpreting potential functional assignments for uncharacterized proteins like MJ1107, researchers should:

  • Apply a confidence scoring system:

    • High confidence: Multiple consistent lines of evidence (sequence, structure, genomic context)

    • Medium confidence: Strong evidence from one approach, supported by weaker evidence from others

    • Low confidence: Single line of evidence or conflicting predictions

  • Consider evolutionary context:

    • Archaeal-specific functions may not align with bacterial or eukaryotic homologs

    • Evaluate evidence in light of M. jannaschii's extremophilic lifestyle and methanogenic metabolism

  • Avoid misidentification pitfalls:

    • Critical components in methanogenic pathways can be misidentified by purely automated approaches

    • For example, MJ0879 was previously misidentified as a general-purpose nitrogenase iron protein rather than a component of Ni-sirohydrochlorin a,c-diamide reductive cyclase

  • Present predictions as testable hypotheses:

    • Clearly distinguish between experimental confirmation and computational prediction

    • As noted in the MjCyc database development, "in the absence of experimental confirmation, all assignments are considered as testable predictions"

  • Utilize pathway reconstruction frameworks:

    • Place predictions within the context of known metabolic pathways

    • Consider how MJ1107 might fit into the 142 pathways identified in M. jannaschii

What statistical approaches are most appropriate for analyzing experimental data related to MJ1107?

When analyzing experimental data for MJ1107, statistical rigor is essential:

  • For comparative experiments (e.g., enzyme activity under different conditions):

    • Use paired t-tests when comparing treatments on the same protein preparation

    • Include appropriate blocking variables in statistical models to account for batch effects

    • Apply non-parametric alternatives when data distribution assumptions are violated

  • For structural studies:

    • Employ appropriate validation metrics for the method used (R-factors for crystallography, NOE violations for NMR)

    • Use ensemble approaches to represent structural flexibility

    • Apply rigorous statistical thresholds for significance in structural comparisons

  • For functional predictions:

    • Calculate false discovery rates when using multiple testing

    • Implement cross-validation strategies for machine learning approaches

    • Report confidence intervals for all predictions

  • Experimental design considerations:

    • Ensure proper replication at the appropriate experimental unit level to avoid pseudoreplication

    • Design experiments with sufficient statistical power to detect biologically meaningful effects

    • As emphasized in methodology literature, "training in experimental design and statistics is critical to ensure that research questions, design considerations, and analyses are aligned"

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.