Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1147 (MJ1147)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is assigned during production. If you require a specific tag, please inform us; we will prioritize your request.
Synonyms
MJ1147; Uncharacterized protein MJ1147
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-462
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1147
Target Protein Sequence
MFILIIKCGIMEKEVISSREFIDRFVECLEKGEDFKLKDCVVEGNVDILNIYEMIKDKEL KGGYIEKKDDEIVVNINIKVDIYNVEFNGDFRFFVNMEYQIVISVFNGNAYFRVITFKGS VYFIRTIFNGDVDFIDTIFEENAYFSVTAFKGNIINFSGTIFNKESHFKSTTFEGNTYFS VTTFNIAEFYNSTFKSHVYFDDISFNLLSFTDCRFRDDVSFKKIDKENFKGLAIFLKTQF LNKHTTIENFQLSKTSFLKTDVREVLLCDVKKEEILSHKILRIKEDSGNKDKDLENKLKE LLGLSYKYIIDQFNYKSVLAEYRNLRISIENNRTYIEASNLYKMEMELIKEFSNGRFEKF IIGAYGAISDYGESMEKTGKWILGSMILFTILASILRFKGMEWDIFKIIEFWWISFWEVI RLFLQIGTEDKSLWILEPIIRVTSLILLGNLYIAVRRKLSRK
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1147

STRING: 243232.MJ_1147

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii protein MJ1147?

MJ1147 is an uncharacterized protein from the hyperthermophilic methanogenic archaeon Methanocaldococcus jannaschii. It is a full-length protein consisting of 462 amino acids that remains functionally uncharacterized despite multiple genome annotation cycles since the original sequencing in 1996 . The protein is available as a recombinant form with His-tag expressed in E. coli for research purposes . Despite notable progress in computational genomics, MJ1147 is among approximately one-third of the M. jannaschii genome that remains functionally uncharacterized .

What genomic context surrounds MJ1147 in the M. jannaschii genome?

Genomic context analysis is crucial for understanding potential functions of uncharacterized proteins. For MJ1147, researchers should examine:

  • Adjacent genes and their functional assignments

  • Operonic structure (if any)

  • Regulatory elements in proximity

  • Comparative genomics with other archaeal species

The MjCyc pathway-genome database contains comprehensive information about the genomic landscape of M. jannaschii and can serve as a starting point for analyzing the context of MJ1147 . Researchers should look for conserved genomic arrangements across related species to identify potential functional associations.

What are the basic structural predictions for MJ1147?

While experimental structural determination is ideal, computational predictions can provide initial insights. Methodological approaches should include:

  • Secondary structure prediction using algorithms such as PSIPRED or JPred

  • Domain architecture analysis using InterPro or SMART

  • Fold recognition using threading approaches (e.g., I-TASSER, Phyre2)

  • Homology modeling if distant homologs with known structures exist

  • Disorder prediction to identify potentially flexible regions

Document all prediction methods used and their confidence scores, as structural predictions for archaeal proteins can be challenging due to limited homology with better-characterized bacterial or eukaryotic proteins.

How should I design experiments to characterize the function of MJ1147?

Effective experimental design for uncharacterized archaeal proteins requires careful planning and consideration of multiple variables . A systematic approach should include:

  • Define your variables:

    • Independent variables: Experimental conditions (temperature, pH, salt concentration, potential substrates)

    • Dependent variables: Measurable outcomes (activity, binding, structural changes)

    • Control variables: Factors that must be kept constant across experiments

  • Formulate specific hypotheses based on bioinformatic predictions and genomic context

  • Design experimental treatments that systematically test each hypothesis

  • Plan measurement methods appropriate for each dependent variable

Experimental ApproachKey Variables to ControlExpected OutcomesLimitations
Biochemical assaysTemperature (80-85°C optimal for M. jannaschii proteins), buffer composition, cofactorsEnzymatic activity, substrate specificityMay not replicate native conditions
Protein-protein interaction studiesExpression tags, binding conditions, controls for non-specific bindingInteraction partners, potential functional complexesHeterologous expression may affect folding
Structural studiesProtein purity, buffer optimization, stabilizing agents3D structure, functional domainsCrystallization of archaeal proteins often challenging
Genetic complementationSelection of appropriate host species, expression levelsFunctional replacement in model organismsHost compatibility issues

Remember that a true experimental design requires manipulation of independent variables and measurement of their effects on dependent variables while controlling extraneous factors .

What are the optimal conditions for expressing recombinant MJ1147 in E. coli?

When expressing archaeal proteins in heterologous bacterial systems, researchers must address several methodological challenges:

  • Codon optimization: M. jannaschii uses different codon preferences than E. coli, requiring codon optimization for efficient expression

  • Expression temperature: While E. coli grows optimally at 37°C, slower expression at lower temperatures (16-25°C) often improves folding of archaeal proteins

  • Selection of expression strain: E. coli strains with enhanced capacity for rare codon translation (e.g., Rosetta) or chaperone co-expression (e.g., Arctic Express) may improve yield

  • Induction conditions: Lower IPTG concentrations (0.1-0.5 mM) and longer induction times often yield better results than standard protocols

  • Solubility enhancement: Fusion tags beyond the His-tag (e.g., MBP, SUMO) may improve solubility

Importantly, purification protocols should be designed with the understanding that while M. jannaschii proteins are naturally stable at extremely high temperatures (up to 85°C), recombinant versions expressed in E. coli may not retain full thermostability .

How can computational methods be used to predict potential functions of MJ1147?

Advanced computational approaches for functional prediction should integrate multiple lines of evidence:

  • Sequence-based methods:

    • PSI-BLAST for distant homology detection

    • Hidden Markov Models for family classification

    • Conservation pattern analysis for functional residues

  • Structural prediction-based methods:

    • Active site prediction based on structural models

    • Ligand binding site prediction

    • Molecular dynamics simulations to assess stability and potential interactions

  • Genomic context methods:

    • Gene neighborhood analysis

    • Phylogenetic profiling

    • Gene fusion detection

  • Pathway-based approaches:

    • Metabolic reconstruction analysis

    • Pathway hole identification

    • Flux balance analysis with and without the protein

The MjCyc pathway-genome database exemplifies how such integrative approaches can lead to novel function predictions, as demonstrated by successful assignments for previously uncharacterized proteins in M. jannaschii . For instance, researchers identified novel functions for several proteins through combined sequence analysis and metabolic reconstruction, including proteins involved in diphthamide biosynthesis and 5,6-dimethylbenzimidazole synthesis .

What experimental designs are most suitable for validating predicted functions of MJ1147?

Function validation requires rigorous experimental designs that control for potential confounding variables :

  • Pre-experimental designs (least robust):

    • One-shot case study: Testing a single condition without controls

    • One-group pretest-posttest: Measuring before and after treatment

    • Static-group comparison: Comparing treated and untreated without randomization

  • True experimental designs (most robust):

    • Pretest-posttest control group design with randomization

    • Solomon four-group design that controls for testing effects

    • Posttest-only control group design when pretesting is impossible

  • Quasi-experimental designs (when full randomization is impossible):

    • Time-series experiments

    • Nonequivalent control group design

    • Multiple time-series design

For MJ1147 specifically, consider designs that incorporate:

  • Positive and negative controls with proteins of known function

  • Multiple assay methods to cross-validate findings

  • Concentration-response relationships to establish specificity

  • Site-directed mutagenesis of predicted functional residues

How does MJ1147 potentially fit into the metabolic network of M. jannaschii?

Understanding the metabolic context requires pathway-genome database integration and systems biology approaches:

The MjCyc pathway-genome database includes 883 reactions, 540 enzymes, and 142 individual pathways that form the metabolic network of M. jannaschii . To position MJ1147 within this network:

  • Examine "pathway holes" where biochemical steps lack assigned genes

  • Analyze expression patterns under different growth conditions

  • Look for co-regulation with genes of known function

  • Consider potential roles in unique archaeal pathways such as methanogenesis

A striking example of contextual function assignment is the identification of MJ0879 as a subunit of Ni-sirohydrochlorin a,c-diamide reductive cyclase (EC 6.3.3.7), an enzyme critical to factor 430 biosynthesis required for methanogenesis, rather than its previous misidentification as a general nitrogenase . Similar contextual analysis could reveal potential functions for MJ1147.

What challenges exist in structural characterization of MJ1147?

Structural studies of archaeal proteins from hyperthermophiles present unique methodological challenges:

  • X-ray crystallography challenges:

    • Obtaining diffraction-quality crystals often requires extensive optimization

    • Unusual surface properties may inhibit crystal contacts

    • High salt requirements can interfere with crystallization

  • NMR spectroscopy challenges:

    • Size limitations (MJ1147 at 462 amino acids may be too large)

    • Isotopic labeling requirements

    • Buffer compatibility issues

  • Cryo-EM approaches:

    • Size limitations (MJ1147 alone may be too small)

    • Sample homogeneity requirements

    • Equipment accessibility

Potential solutions include:

  • Fragmenting the protein into functional domains for structural studies

  • Co-crystallization with potential binding partners or substrates

  • Stabilizing mutations based on computational predictions

  • Using archaeal-specific crystallization screens with high salt concentrations

How can I determine if predicted protein-protein interactions involving MJ1147 are biologically relevant?

Validating protein-protein interactions for archaeal proteins requires specialized approaches:

  • In vitro validation methods:

    • Pull-down assays with controls for non-specific binding

    • Surface plasmon resonance with temperature control for thermophilic conditions

    • Isothermal titration calorimetry to determine binding constants

    • Native gel electrophoresis under controlled temperature conditions

  • Computational validation:

    • Conservation of interaction interfaces across species

    • Co-evolution analysis of potentially interacting proteins

    • Structural modeling of interaction interfaces

  • Experimental design considerations:

    • Use true experimental designs with appropriate controls

    • Include non-interacting protein pairs as negative controls

    • Test interactions under native-like conditions (temperature, salt)

    • Validate using multiple independent methods

When publishing interaction results, ensure reporting follows the IMEx consortium guidelines for protein interaction data to maximize reproducibility and utility to the research community.

What novel approaches might accelerate functional characterization of proteins like MJ1147?

Emerging technologies and interdisciplinary approaches offer new possibilities:

  • Deep learning approaches:

    • AlphaFold2 and similar tools for more accurate structural prediction

    • Machine learning models trained on archaeal-specific datasets

    • Neural networks that integrate multiple data types for function prediction

  • High-throughput experimental approaches:

    • Activity-based protein profiling

    • Thermal proteome profiling

    • Metabolomic screening upon expression

  • Systems biology integration:

    • Multi-omics data integration

    • Constraint-based modeling of metabolic networks

    • In silico metabolic flux analysis

  • Archaeal-specific genetic tools:

    • Development of better genetic systems for M. jannaschii

    • CRISPR-based approaches adapted for archaeal systems

    • Conditional expression systems for functional validation

The MjCyc pathway-genome database represents an important step toward integrative functional prediction, but continued experimental validation remains essential for confirming computational predictions .

How might studying MJ1147 contribute to understanding archaeal evolution and adaptation?

Investigating uncharacterized proteins like MJ1147 contributes to broader evolutionary questions:

  • Archaeal uniqueness:

    • Does MJ1147 represent an archaeal-specific adaptation?

    • Could it be involved in unique biochemical pathways not found in bacteria or eukaryotes?

  • Extremophile adaptations:

    • What structural features might contribute to extreme thermostability?

    • How do protein-protein interactions differ in hyperthermophilic environments?

  • Ancient protein functions:

    • Could MJ1147 represent an ancient protein function predating the divergence of major domains?

    • What does its distribution across archaeal lineages suggest about its evolutionary history?

  • Experimental approaches:

    • Comparative genomics across archaeal species with varying growth temperatures

    • Ancestral sequence reconstruction and characterization

    • Horizontal gene transfer analysis

Experimental designs for these evolutionary questions should follow true experimental design principles with appropriate controls and consideration of both internal and external validity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.