Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1155.1 (MJ1155.1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ1155.1; Uncharacterized protein MJ1155.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1155.1
Target Protein Sequence
MDKNILAIIFVAVGTYLIRYIPIHLHSKIKNIDEKVKEINEILIYSSTSVISALFITSFI KFPIIFSNVLISTISLIFAIVSYKKWNNLGISILISVVIYYLASKFLISI
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for studying uncharacterized proteins?

Methanocaldococcus jannaschii is a thermophilic methanogen belonging to the domain Archaea. It holds significant historical and scientific importance as the first archaeal organism to have its genome completely sequenced. The organism possesses a large circular chromosome that is 1.66 mega base pairs long with a G+C content of 31.4%, along with large and small circular extra-chromosomes .

The significance of M. jannaschii for studying uncharacterized proteins stems from several factors:

  • As a model archaeal organism with a completely sequenced genome, it provides an excellent platform for understanding archaeal-specific protein functions.

  • It contains numerous novel metabolic pathways that have been worked out, including pathways for synthesis of methanogenic cofactors and unique amino acid synthesis pathways .

  • The organism contains a large number of inteins (19 discovered in one study), making it valuable for studying protein splicing mechanisms .

  • Its extremophilic nature (thermophilic, growing at high temperatures) means its proteins often have unique structural adaptations that can inform protein engineering.

What methodological approaches should be employed to initially characterize an uncharacterized protein like MJ1155.1?

Initial characterization of MJ1155.1 should follow a systematic approach:

  • Bioinformatic analysis:

    • Sequence homology searches using BLAST, HHpred, or HMMER

    • Domain architecture analysis using InterPro, Pfam, or SMART

    • Secondary structure prediction using PSIPRED or JPred

    • Transmembrane region prediction using TMHMM or Phobius

    • Subcellular localization prediction using PSORTb or CELLO

  • Experimental verification of expression:

    • RT-PCR to confirm transcription in native organism

    • Proteomics approaches to confirm translation (mass spectrometry)

    • Western blotting using custom antibodies if available

  • Recombinant expression:

    • Design codon-optimized construct

    • Test multiple expression systems (E. coli, yeast, insect cells)

    • Optimize expression conditions (temperature, inducer concentration, duration)

    • Purify using affinity chromatography and other methods

  • Basic biochemical characterization:

    • Molecular weight determination (SDS-PAGE, mass spectrometry)

    • Secondary structure analysis (circular dichroism)

    • Thermal stability assessment (differential scanning fluorimetry)

    • Initial activity screens based on bioinformatic predictions

Hypothetical proteins (HPs) like MJ1155.1 make up a substantial fraction of proteomes in both prokaryotes and eukaryotes. They are typically predicted to be expressed from an open reading frame identified during genome annotation .

How should expression systems be optimized for recombinant production of archaeal proteins like MJ1155.1?

Optimizing expression systems for archaeal proteins requires addressing several challenges:

Expression System Selection:

  • E. coli systems: Most commonly used, but may struggle with archaeal proteins

    • BL21(DE3) for standard expression

    • Rosetta strains to address codon bias

    • ArcticExpress for cold-temperature expression of thermophilic proteins

    • C41/C43 strains for potentially toxic proteins

  • Yeast systems: Better for archaeal proteins requiring eukaryotic-like post-translational modifications

    • Pichia pastoris for high-yield expression

    • Saccharomyces cerevisiae for complex proteins

  • Cell-free systems: Useful for toxic or difficult-to-express proteins

    • PURE system with reconstituted translation machinery

    • Archaeal cell-free systems for native-like conditions

Optimization Parameters:

  • Temperature: Lower temperatures (16-25°C) often improve folding despite M. jannaschii being thermophilic

  • Induction conditions: IPTG concentration (0.01-1 mM), duration (4-24 hours)

  • Media formulation: Rich media (LB, TB) vs. minimal media

  • Codon optimization: Adjust for expression host while preserving critical structures

Expression and Solubility Enhancement:

  • Fusion tags: MBP, SUMO, or Thioredoxin to improve solubility

  • Chaperone co-expression: GroEL/ES, DnaK/J/GrpE systems

  • Lysis buffer optimization: Various detergents, salt concentrations, pH values

Experimental Validation Table:

What analytical techniques are most effective for validating protein characterization of recombinant MJ1155.1?

Mass spectrometry serves as a primary analytical technique for validating protein characterization . For recombinant MJ1155.1, the following analytical techniques are recommended:

  • Mass Spectrometry Approaches:

    • Intact protein MS to confirm molecular weight

    • Peptide mass fingerprinting following protease digestion

    • Tandem MS (MS/MS) for sequence verification

    • Hydrogen-deuterium exchange MS for structural insights

    • Cross-linking MS for interaction studies

  • Chromatographic Methods:

    • Size-exclusion chromatography to assess oligomeric state

    • Ion-exchange chromatography for charge variant analysis

    • Reverse-phase HPLC for purity assessment

    • Affinity chromatography to investigate binding partners

  • Spectroscopic Techniques:

    • Circular dichroism for secondary structure composition

    • Fluorescence spectroscopy for tertiary structure and ligand binding

    • NMR spectroscopy for structural characterization

    • Thermal shift assays for stability assessment

  • Functional Validation:

    • Activity assays based on bioinformatic predictions

    • Binding assays with potential substrates or interactors

    • Protein-protein interaction studies (pull-downs, SPR, ITC)

Mass spectrometry is particularly valuable as it can provide definitive identification through peptide sequencing, confirm post-translational modifications, and help validate the expression of the correct protein construct .

How can computational methods be employed to predict the potential function of MJ1155.1?

Computational methods for predicting the function of uncharacterized proteins like MJ1155.1 employ a multi-layered approach:

  • Sequence-Based Methods:

    • Homology detection using PSI-BLAST, HHpred, and HMMER

    • Motif identification using PROSITE, PRINTS, or BLOCKS

    • Functional domain prediction using Pfam, SMART, or CDD

    • Gene neighborhood analysis for functional context

  • Structure-Based Predictions:

    • Homology modeling using tools like SWISS-MODEL, Phyre2, or I-TASSER

    • Ab initio structure prediction using AlphaFold2 or RoseTTAFold

    • Binding site prediction using CASTp, COACH, or SiteMap

    • Molecular docking with potential ligands

  • Systems Biology Approaches:

    • Gene co-expression analysis

    • Phylogenetic profiling to identify functionally linked genes

    • Protein-protein interaction network analysis

    • Metabolic pathway gap analysis

  • Machine Learning Methods:

    • Support vector machines for function classification

    • Neural network approaches for integrated feature analysis

    • Random forest algorithms for combining diverse evidence

The combination of these methods substantially increases confidence in functional predictions. For conserved hypothetical proteins (CHPs) like MJ1155.1 that are conserved across phylogenetic lineages but lack functional validation, these computational approaches are especially valuable .

Prediction Confidence Matrix:

MethodConfidence LevelValidation RequiredTypical Output
Sequence homologyHigh (>40% identity)
Medium (20-40%)
Low (<20%)
Experimental verification of predicted activityPotential function based on characterized homologs
Structural similarityHigh (similar fold + conserved active site)
Medium (similar fold only)
Low (partial structural match)
Biochemical assays for predicted activityPotential biochemical function
Gene neighborhoodHigh (conserved operon structure)
Medium (partial conservation)
Low (species-specific arrangement)
Gene deletion/expression studiesPathway involvement
Machine learningVaries by algorithm and training set qualityMultiple experimental approachesProbabilistic functional classification

What experimental approaches would best determine the function of MJ1155.1 when computational predictions provide limited insights?

When computational methods yield limited insights, systematic experimental approaches are essential:

  • Activity-Based Protein Profiling:

    • Chemical probes that react with specific enzyme classes

    • Detection of functional reactivity without prior knowledge

    • Identification of catalytic residues and mechanisms

  • Metabolite Profiling:

    • Comparing metabolomes in knockout/overexpression strains

    • Identifying substrate or product accumulation

    • Isotope labeling to trace metabolic flux

  • Protein Interaction Studies:

    • Affinity purification coupled with mass spectrometry

    • Yeast two-hybrid or bacterial two-hybrid screening

    • Protein microarrays to identify binding partners

    • Proximity labeling methods (BioID, APEX)

  • Phenotypic Studies:

    • Gene knockout/knockdown phenotype analysis

    • Overexpression studies to observe gain-of-function effects

    • Complementation assays in model organisms

  • Systematic Substrate Screening:

    • Biologically relevant compound libraries

    • High-throughput enzymatic assays

    • Differential scanning fluorimetry for ligand binding

Microarrays and protein expression profiles can help understand biological systems through systems-wide study of proteins and their interactions with other proteins and non-proteinaceous molecules to control complex processes in cells .

How do archaeal-specific features of M. jannaschii impact experimental approaches when characterizing MJ1155.1?

The unique characteristics of M. jannaschii create several experimental considerations:

  • Thermostability Considerations:

    • Enzyme assays must be performed at elevated temperatures (optimal growth at 85°C)

    • Buffer stability becomes critical at high temperatures

    • Specialized equipment required for high-temperature incubations

    • Potential for protein misfolding at lower temperatures

  • Anaerobic Requirements:

    • As a methanogen, M. jannaschii grows in strictly anaerobic conditions

    • Oxygen-sensitive proteins may require anaerobic chambers for handling

    • Specialized anaerobic expression systems may be necessary

    • Activity assays may need to be conducted under anaerobic conditions

  • Unique Coenzymes and Cofactors:

    • M. jannaschii utilizes unique cofactors for methanogenesis

    • Novel metabolic pathways have been identified

    • Cofactor availability may limit activity in heterologous systems

    • Reconstitution with archaeal-specific factors may be necessary

  • Archaeal-Specific Post-Translational Modifications:

    • Non-canonical modifications may be required for activity

    • Heterologous systems may not reproduce native modifications

    • Mass spectrometric analysis critical for PTM identification

  • Genetic System Limitations:

    • Limited genetic tools available for direct manipulation

    • Challenges in creating knockout strains for validation

    • Need for surrogate systems to test function

M. jannaschii is known to contain many hydrogenases and novel metabolic pathways for synthesis of methanogenic cofactors and amino acids. It also has archaeal-specific information processing pathways that must be considered when analyzing protein function .

What challenges arise in analyzing contradictory experimental data when characterizing novel proteins like MJ1155.1?

Contradictory experimental data is common when characterizing novel proteins and requires systematic resolution approaches:

  • Sources of Experimental Contradiction:

    • Expression system artifacts (E. coli vs. native expression)

    • Buffer/condition-dependent activity differences

    • Inadvertent protein modifications during purification

    • Presence/absence of critical cofactors

    • Oligomerization state differences

    • Contaminating activities from expression host

  • Resolution Strategies:

    • Systematically vary experimental conditions to identify critical parameters

    • Employ multiple independent methodologies to validate results

    • Use negative and positive controls rigorously

    • Implement isothermal titration calorimetry or microscale thermophoresis for binding studies

    • Perform enzyme kinetics across varied conditions

  • Data Integration Approach:

    Data TypeContradictionResolution StrategyValidation Method
    Activity assaysActivity in buffer A but not buffer BIdentify critical buffer componentsSystematic buffer optimization
    Binding studiesBinding observed by method 1 but not method 2Compare detection limits and conditionsOrthogonal third method
    Structural dataDifferent conformations in different conditionsDetermine physiologically relevant conditionsIn vivo validation
    In vivo vs. in vitroFunction observed in vitro but not in vivoIdentify missing cofactors or partnersReconstitution experiments
  • Documentation Practices:

    • Maintain detailed records of all experimental conditions

    • Report negative results alongside positive findings

    • Clearly state limitations of each method

    • Publish comprehensive methods to enable replication

What approaches can determine if MJ1155.1 contains intein sequences and how do these affect protein characterization?

M. jannaschii is known to contain a large number of inteins, with 19 discovered in one study . Determining if MJ1155.1 contains inteins requires:

  • Computational Detection Methods:

    • Sequence analysis using the InBase database

    • Identification of conserved splicing motifs (blocks A, B, F, G)

    • Recognition of characteristic HEN domain sequences

    • Detection of split inteins through complementary fragments

  • Experimental Verification Methods:

    • Size comparison between predicted and observed protein

    • Western blot analysis to identify precursor and processed forms

    • Mass spectrometry to confirm splicing junctions

    • Expression of segments to confirm self-splicing activity

  • Impact on Protein Characterization:

    • Inteins may affect protein folding and stability

    • Incomplete splicing can produce heterogeneous protein samples

    • Active HEN domains may have cytotoxic effects in expression hosts

    • Splicing efficiency may be condition-dependent

  • Strategies for Handling Intein-Containing Proteins:

    • Express protein at low temperatures to improve splicing efficiency

    • Engineer construct to remove inteins if they interfere with function

    • Utilize inteins as purification tools via controlled splicing

    • Compare properties of spliced and unspliced forms

Intein Analysis Workflow:

  • Bioinformatic prediction of potential intein sequences

  • Design constructs with and without predicted inteins

  • Express both constructs and compare size and activity

  • Confirm splicing via mass spectrometry

  • Assess impact of intein removal on structure and function

How can Argonaute-related functions be investigated if MJ1155.1 shows sequence similarity to archaeal Argonaute proteins?

If MJ1155.1 shows similarity to archaeal Argonaute proteins, investigation should focus on potential nucleic acid processing activities:

  • Assessing Guide-Dependent Activities:

    • DNA cleavage assays with synthetic guide strands

    • RNA cleavage assays with various guide molecules

    • Binding affinity measurements for different nucleic acids

    • Structural analysis of potential guide binding domains

  • Investigating Guide-Independent Functions:

    • Testing for guide-independent DNA endonuclease activity similar to MjAgo

    • Assessing ability to process double-stranded DNA substrates

    • Testing activity on circular DNA molecules

    • Evaluating activity on chromatinized vs. naked DNA

  • Mechanistic Studies:

    • Site-directed mutagenesis of predicted catalytic residues

    • Determining temperature-dependence of nuclease activity

    • Testing metal ion requirements for catalytic function

    • Comparing activity to characterized MjAgo protein

  • Physiological Context Investigation:

    • Analyzing genomic context for potential functional clues

    • Determining expression patterns under different conditions

    • Testing interaction with other DNA processing enzymes

    • Investigating potential role in defense against mobile genetic elements

The archaeal Argonaute from M. jannaschii (MjAgo) possesses both canonical guide-dependent endonuclease activity and guide-independent DNA endonuclease activity, allowing it to process long double-stranded DNAs, including circular plasmid DNAs and genomic DNAs . This dual functionality could inform investigations of MJ1155.1 if sequence similarities are found.

What emerging technologies show the most promise for functional annotation of archaeal hypothetical proteins like MJ1155.1?

Several cutting-edge technologies are revolutionizing the functional characterization of hypothetical proteins:

  • Deep Learning Approaches:

    • AlphaFold2 and RoseTTAFold for accurate structure prediction

    • Deep learning-based function prediction from structure

    • Language model approaches (like ESM-1b) for functional inference

    • Graph neural networks for integrating multi-omics data

  • Single-Molecule Techniques:

    • Single-molecule FRET for dynamic structural analysis

    • Nanopore sensing for interaction studies

    • Optical tweezers for measuring mechanical properties

    • Super-resolution microscopy for localization studies

  • High-Throughput Phenotyping:

    • CRISPR interference screens in model organisms

    • Transposon sequencing for fitness profiling

    • Synthetic genetic array analysis for genetic interactions

    • Automated growth phenotyping under various conditions

  • Multi-Omics Integration:

    • Integrated proteomics, metabolomics, and transcriptomics

    • Protein correlation profiling across conditions

    • Thermal proteome profiling for ligand discovery

    • Activity-based proteomics for functional classification

  • Microfluidic Applications:

    • Droplet-based enzyme evolution systems

    • Microfluidic protein crystallization

    • Single-cell protein expression analysis

    • High-throughput biochemical assays

Next-generation sequencing methods have accelerated multiple areas of genomics with special focus on uncharacterized proteins, enabling more comprehensive functional annotation strategies .

How might systems biology approaches illuminate the role of MJ1155.1 in M. jannaschii metabolism?

Systems biology offers powerful approaches to contextualize the function of MJ1155.1:

  • Metabolic Network Analysis:

    • Genome-scale metabolic model construction

    • Flux balance analysis to predict metabolic roles

    • Identification of essential reactions and pathways

    • Prediction of growth phenotypes under different conditions

  • Protein-Protein Interaction Networks:

    • Affinity purification-mass spectrometry to identify partners

    • Bacterial two-hybrid screens for interaction mapping

    • Computational prediction of interaction networks

    • Cross-linking mass spectrometry for structural interactions

  • Transcriptional Response Mapping:

    • RNA-seq under various growth conditions

    • ChIP-seq to identify regulatory interactions

    • Identification of co-regulated gene clusters

    • Transcription factor binding site analysis

  • Comparative Genomics:

    • Phylogenetic profiling across archaeal species

    • Gene neighborhood conservation analysis

    • Horizontal gene transfer detection

    • Evolutionary rate analysis for functional inference

  • Integrated Multi-Omics:

    • Correlation of protein abundance with metabolite levels

    • Integration of transcriptome, proteome, and metabolome data

    • Condition-specific protein expression profiling

    • Network-based functional prediction

Systems biology approaches help understand biological systems through systems-wide study of proteins and their interactions with other proteins and non-proteinaceous molecules to control complex processes in cells .

Data Integration Framework:

Data TypeAnalytical MethodExpected InsightIntegration Approach
TranscriptomicsRNA-seq, microarrayCo-expression patternsWeighted gene correlation network analysis
ProteomicsLC-MS/MS, protein arraysProtein abundance, PTMsProtein correlation profiling
MetabolomicsGC-MS, LC-MSMetabolic impactPathway enrichment analysis
InteractomicsAP-MS, Y2HFunctional contextNetwork centrality analysis
PhenomicsGrowth assays, fitness profilingPhysiological rolePhenotype ontology mapping

These integrated approaches provide a comprehensive framework for elucidating the function of uncharacterized proteins like MJ1155.1 within the broader context of M. jannaschii biology and metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.