Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1161 (MJ1161) is a protein derived from the archaeon Methanocaldococcus jannaschii . M. jannaschii is a hyperthermophilic methanogen, meaning it thrives in extremely hot environments and produces methane as a metabolic byproduct . MJ1161 is currently annotated as an uncharacterized protein, which means its specific function within the organism is not yet known . Despite being uncharacterized, its gene sequence and some structural features have been identified .
MJ1161 is a transmembrane protein, indicating it is located within a cell membrane . The amino acid sequence of MJ1161 is known, which allows for the prediction of structural motifs and potential functional domains . Determining the structure of proteins like MJ1161 is crucial to understanding their function . The sequence of MJ1161 is as follows :
MRDNIRSINKLLIYLVLILSAMFLCQNVFAEDYNAIEITVKNISSGEILYQKIFPKDEAFSDYQVINGFTIDIHYNPNYPGMVYKVHQSNNHFIFNVSGELNWGSYQQSGDIACIVDVIHYDFPPPSNTTSNTTTTSSSSTKAPIPLSVYLAITAFFTYIIYRKSKT
As the name suggests, the precise function of MJ1161 has not been fully elucidated . Many proteins in M. jannaschii remain functionally uncharacterized, despite advancements in genomic analysis . It has been suggested that MJ1099, another protein in M. jannaschii, plays a role in the biosynthesis of tetrahydromethanopterin and methanofuran, which are key cofactors in C1 metabolism . Further studies, including those on MJ1161 homologs, could provide insights into its function, possibly through mechanistic studies or the development of inhibitors .
To study the function of proteins in M. jannaschii, genetic systems have been developed to overexpress specific proteins . For example, a system was created to overexpress Mj-FprA using a suicide plasmid, allowing for a more detailed analysis of its function . A similar approach could be applied to MJ1161, which would involve cloning the MJ1161 gene into an expression vector and introducing it into M. jannaschii or another suitable host organism .
Although MJ1161 is currently uncharacterized, understanding its function could have several applications:
Understanding Methanogenesis: Elucidating the roles of uncharacterized proteins like MJ1161 can improve our understanding of methanogenesis, a process with significant environmental implications .
Biotechnology: Identifying the function of MJ1161 could reveal novel enzymatic activities or metabolic pathways that could be exploited for biotechnological applications .
Drug Development: If MJ1161 is essential for the survival or virulence of M. jannaschii, it could be a potential drug target. Inhibitors could be developed to target methanogenic archaea in specific environments .
KEGG: mja:MJ_1161
STRING: 243232.MJ_1161
MJ1161 is an uncharacterized protein from Methanocaldococcus jannaschii, a phylogenetically deeply rooted archaeon first isolated from a deep-sea hydrothermal vent . The protein is significant because it comes from an organism that performs one of the most ancient respiratory metabolisms on Earth, which developed approximately 3.49 billion years ago .
M. jannaschii was the first archaeon for which the whole genome sequence was determined, yet for 60% of its genes, including MJ1161, even a predicted function could not be assigned . Studying uncharacterized proteins like MJ1161 can provide insights into novel metabolic features and the genomic basis for special features of archaea, potentially uncovering fundamental biological processes that have been conserved throughout evolution.
Based on available data, recombinant MJ1161 has the following properties:
| Property | Details |
|---|---|
| Full Length | 1-167 amino acids |
| Source | Expressed in E. coli |
| Species | Methanocaldococcus jannaschii |
| Tags | His-Tag |
| Product Code | CSB-CF701448MRU |
| Database Identifiers | KEGG: mja:MJ_1161, STRING: 243232.MJ_1161 |
The recombinant protein is typically produced using in vitro E. coli expression systems . As an archaeal protein from a hyperthermophile, it likely possesses thermostable properties, though specific biochemical characterization data is currently limited in the literature.
M. jannaschii requires highly specialized growth conditions:
Atmosphere: Anaerobic conditions with H₂ and CO₂ (80:20, v/v)
Growth characteristics: Extremely fast growth with doubling time of approximately 26 minutes
Special considerations: Cultures grow to stationary phase within hours, requiring frequent monitoring rather than overnight incubation
Researchers should follow special instructions for the cultivation of anaerobes, hyperthermophiles, and methanogens when working with this organism . The cells are typically harvested by centrifugation at 3,000 rpm when the culture reaches an optical density of 0.5-0.7 at 600 nm, which corresponds to approximately 2-4 × 10⁸ cells/ml .
Characterizing uncharacterized proteins like MJ1161 requires a multi-faceted approach:
Bioinformatic analysis:
Structural studies:
Protein-protein interaction studies:
Functional assays:
When conducting these studies, proper experimental design is crucial. Researchers should implement randomization in experimental design, use blinding for qualitative assessments, and consider factorial designs when appropriate to maximize information while minimizing the number of experiments .
A genetic system for M. jannaschii has been recently developed, opening new possibilities for studying proteins like MJ1161 in their native context . This system includes:
Transformation protocol:
Genome modification strategies:
Expression systems:
This genetic system typically yields 10⁴ transformants per μg of plasmid DNA, which is sufficient for most genetic manipulation purposes .
For uncharacterized proteins like MJ1161, effective bioinformatic prediction requires a comprehensive approach:
Sequence analysis:
Structure prediction:
Function prediction:
These approaches have successfully assigned functions to previously uncharacterized proteins, identifying enzymes, transporter proteins, membrane proteins, and binding proteins . The efficacy of the databases employed for prediction can be determined using receiver operating characteristics, with accuracy rates of approximately 83.6% .
The genetic system for M. jannaschii has several distinctive features compared to other archaeal systems:
| Feature | M. jannaschii | M. maripaludis | Methanosarcina species | Pyrococcus furiosus |
|---|---|---|---|---|
| DNA delivery method | Heat shock | Polyethylene glycol | Liposomes | Heat shock |
| Time to generate colonies | 3-4 days | ~7 days | ~14 days | Variable |
| Doubling time | 26 min | 2 hours | 8.5 hours | Longer |
| Selection marker | Mevinolin resistance | Various | Various | Various |
| DNA format for transformation | Linear suicide vectors | Various | Various | Various |
When designing experiments for thermostable proteins from hyperthermophiles like M. jannaschii, several critical considerations must be addressed:
Temperature stability of reagents and equipment:
Ensure all buffers, reagents, and equipment can withstand high temperatures
Consider using specialized high-temperature stable enzymes for molecular biology work
Appropriate controls:
Statistical rigor:
Special assay considerations:
A survey of experimental design quality found that only 12% of studies reported random allocation to treatment groups, and only 14% reported using blinding for qualitative assessments . These methodological considerations are particularly important when working with unusual proteins like MJ1161.
Validation of predicted functions requires multiple lines of evidence:
Biochemical validation:
Genetic validation:
Structural validation:
Interactome studies:
Case studies like those conducted with DNM2 protein demonstrate how two-way co-immunoprecipitation can confirm protein interactions, while inhibitor studies can validate functional relationships .
Functional characterization of MJ1161 could provide significant evolutionary insights:
Ancient metabolic pathways:
Adaptation to extreme environments:
Minimal requirements for life:
Comparative genomics:
The characterization of MJ1161 could contribute to our understanding of early life on Earth and the evolution of fundamental biological processes, with potential implications for astrobiology and the search for life in extreme environments.