Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1161 (MJ1161)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1161 (MJ1161) is a protein derived from the archaeon Methanocaldococcus jannaschii . M. jannaschii is a hyperthermophilic methanogen, meaning it thrives in extremely hot environments and produces methane as a metabolic byproduct . MJ1161 is currently annotated as an uncharacterized protein, which means its specific function within the organism is not yet known . Despite being uncharacterized, its gene sequence and some structural features have been identified .

FeatureDescription
Product CodeCSB-CF701448MRU
StorageStore at -20°C; for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week .
Uniprot No.Q58561
Product TypeTransmembrane Protein
Immunogen SpeciesMethanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
SequenceMRDNIRSINKLLIYLVLILSAMFLCQNVFAEDYNAIEITVKNISSGEILYQKIFPKDEAFSDYQVINGFTIDIHYNPNYPGMVYKVHQSNNHFIFNVSGELNWGSYQQSGDIACIVDVIHYDFPPPSNTTSNTTTTSSSSTKAPIPLSVYLAITAFFTYIIYRKSKT
SourceIn vitro E. coli expression system
Target NamesMJ1161
Protein NamesUncharacterized protein MJ1161
Expression Region1-167
Tag InfoN-terminal 10xHis-tagged
Protein LengthFull length protein
Shelf LifeLiquid form: 6 months at -20°C/-80°C; Lyophilized form: 12 months at -20°C/-80°C

Structure

MJ1161 is a transmembrane protein, indicating it is located within a cell membrane . The amino acid sequence of MJ1161 is known, which allows for the prediction of structural motifs and potential functional domains . Determining the structure of proteins like MJ1161 is crucial to understanding their function . The sequence of MJ1161 is as follows :

MRDNIRSINKLLIYLVLILSAMFLCQNVFAEDYNAIEITVKNISSGEILYQKIFPKDEAFSDYQVINGFTIDIHYNPNYPGMVYKVHQSNNHFIFNVSGELNWGSYQQSGDIACIVDVIHYDFPPPSNTTSNTTTTSSSSTKAPIPLSVYLAITAFFTYIIYRKSKT

Function and Role in Methanocaldococcus jannaschii

As the name suggests, the precise function of MJ1161 has not been fully elucidated . Many proteins in M. jannaschii remain functionally uncharacterized, despite advancements in genomic analysis . It has been suggested that MJ1099, another protein in M. jannaschii, plays a role in the biosynthesis of tetrahydromethanopterin and methanofuran, which are key cofactors in C1 metabolism . Further studies, including those on MJ1161 homologs, could provide insights into its function, possibly through mechanistic studies or the development of inhibitors .

Genetic System and Overexpression

To study the function of proteins in M. jannaschii, genetic systems have been developed to overexpress specific proteins . For example, a system was created to overexpress Mj-FprA using a suicide plasmid, allowing for a more detailed analysis of its function . A similar approach could be applied to MJ1161, which would involve cloning the MJ1161 gene into an expression vector and introducing it into M. jannaschii or another suitable host organism .

Potential Applications

Although MJ1161 is currently uncharacterized, understanding its function could have several applications:

  • Understanding Methanogenesis: Elucidating the roles of uncharacterized proteins like MJ1161 can improve our understanding of methanogenesis, a process with significant environmental implications .

  • Biotechnology: Identifying the function of MJ1161 could reveal novel enzymatic activities or metabolic pathways that could be exploited for biotechnological applications .

  • Drug Development: If MJ1161 is essential for the survival or virulence of M. jannaschii, it could be a potential drug target. Inhibitors could be developed to target methanogenic archaea in specific environments .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, specific format requests should be noted during order placement to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its inclusion in the production process.
Synonyms
MJ1161; Uncharacterized protein MJ1161
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1161
Target Protein Sequence
MRDNIRSINKLLIYLVLILSAMFLCQNVFAEDYNAIEITVKNISSGEILYQKIFPKDEAF SDYQVINGFTIDIHYNPNYPGMVYKVHQSNNHFIFNVSGELNWGSYQQSGDIACIVDVIH YDFPPPSNTTSNTTTTSSSSTKAPIPLSVYLAITAFFTYIIYRKSKT
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1161

STRING: 243232.MJ_1161

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MJ1161 and why is it significant for research?

MJ1161 is an uncharacterized protein from Methanocaldococcus jannaschii, a phylogenetically deeply rooted archaeon first isolated from a deep-sea hydrothermal vent . The protein is significant because it comes from an organism that performs one of the most ancient respiratory metabolisms on Earth, which developed approximately 3.49 billion years ago .

M. jannaschii was the first archaeon for which the whole genome sequence was determined, yet for 60% of its genes, including MJ1161, even a predicted function could not be assigned . Studying uncharacterized proteins like MJ1161 can provide insights into novel metabolic features and the genomic basis for special features of archaea, potentially uncovering fundamental biological processes that have been conserved throughout evolution.

What are the basic properties of recombinant MJ1161 protein?

Based on available data, recombinant MJ1161 has the following properties:

PropertyDetails
Full Length1-167 amino acids
SourceExpressed in E. coli
SpeciesMethanocaldococcus jannaschii
TagsHis-Tag
Product CodeCSB-CF701448MRU
Database IdentifiersKEGG: mja:MJ_1161, STRING: 243232.MJ_1161

The recombinant protein is typically produced using in vitro E. coli expression systems . As an archaeal protein from a hyperthermophile, it likely possesses thermostable properties, though specific biochemical characterization data is currently limited in the literature.

What cultivation conditions are required for M. jannaschii as the native source of MJ1161?

M. jannaschii requires highly specialized growth conditions:

  • Temperature: 80°C (optimal growth temperature)

  • Medium: Medium 282 (specific for methanogens)

  • Atmosphere: Anaerobic conditions with H₂ and CO₂ (80:20, v/v)

  • Growth characteristics: Extremely fast growth with doubling time of approximately 26 minutes

  • Special considerations: Cultures grow to stationary phase within hours, requiring frequent monitoring rather than overnight incubation

Researchers should follow special instructions for the cultivation of anaerobes, hyperthermophiles, and methanogens when working with this organism . The cells are typically harvested by centrifugation at 3,000 rpm when the culture reaches an optical density of 0.5-0.7 at 600 nm, which corresponds to approximately 2-4 × 10⁸ cells/ml .

What approaches can be used to characterize the function of MJ1161?

Characterizing uncharacterized proteins like MJ1161 requires a multi-faceted approach:

  • Bioinformatic analysis:

    • Prediction of physicochemical parameters

    • Domain and motif searches

    • Pattern identification

    • Subcellular localization prediction

    • String analysis to identify potential interacting partners

  • Structural studies:

    • Homology-based structure prediction using Swiss PDB and Phyre2 servers

    • X-ray crystallography or cryo-EM for definitive structure determination

  • Protein-protein interaction studies:

    • Yeast two-hybrid screening (as demonstrated with other uncharacterized proteins like FAM47E)

    • Co-immunoprecipitation assays

    • Pull-down assays with potential interacting partners

  • Functional assays:

    • Enzymatic activity measurements based on structural predictions

    • In vitro reconstitution of predicted pathways

    • Heterologous expression and phenotypic analysis

When conducting these studies, proper experimental design is crucial. Researchers should implement randomization in experimental design, use blinding for qualitative assessments, and consider factorial designs when appropriate to maximize information while minimizing the number of experiments .

How can genetic tools be used to study MJ1161 in its native context?

A genetic system for M. jannaschii has been recently developed, opening new possibilities for studying proteins like MJ1161 in their native context . This system includes:

  • Transformation protocol:

    • Growth of cells to OD600 of 0.5-0.7

    • Harvest cells by centrifugation at 3,000 rpm

    • Resuspend in pre-reduced medium containing sodium sulfide

    • Incubate at 4°C for 30 minutes

    • Add linearized plasmid DNA

    • Heat shock at 85°C for 45 seconds

    • Plate on selective media

  • Genome modification strategies:

    • Double cross-over homologous recombination using suicide vectors

    • Selection using mevinolin resistance

    • Verification of genetic modifications by PCR

  • Expression systems:

    • Use of native promoters like P* and PflaB1B2

    • Introduction of affinity tags (e.g., 3xFLAG-twin Strep tag) for purification

    • Overexpression of target proteins

This genetic system typically yields 10⁴ transformants per μg of plasmid DNA, which is sufficient for most genetic manipulation purposes .

What bioinformatic methods are most effective for predicting the function of uncharacterized proteins like MJ1161?

For uncharacterized proteins like MJ1161, effective bioinformatic prediction requires a comprehensive approach:

  • Sequence analysis:

    • Multiple sequence alignment with homologs

    • Identification of conserved residues

    • Phylogenetic analysis to identify evolutionary relationships

  • Structure prediction:

    • Ab initio modeling

    • Threading approaches

    • Homology modeling

    • Assessment of model quality using validation tools

  • Function prediction:

    • Gene ontology term assignment

    • Protein family classification

    • Prediction of binding sites and active sites

    • Molecular docking with potential ligands

These approaches have successfully assigned functions to previously uncharacterized proteins, identifying enzymes, transporter proteins, membrane proteins, and binding proteins . The efficacy of the databases employed for prediction can be determined using receiver operating characteristics, with accuracy rates of approximately 83.6% .

How does the genetic system for M. jannaschii compare to those for other archaeal species?

The genetic system for M. jannaschii has several distinctive features compared to other archaeal systems:

FeatureM. jannaschiiM. maripaludisMethanosarcina speciesPyrococcus furiosus
DNA delivery methodHeat shockPolyethylene glycolLiposomesHeat shock
Time to generate colonies3-4 days~7 days~14 daysVariable
Doubling time26 min2 hours8.5 hoursLonger
Selection markerMevinolin resistanceVariousVariousVarious
DNA format for transformationLinear suicide vectorsVariousVariousVarious

What experimental design considerations are critical when working with thermostable proteins like MJ1161?

When designing experiments for thermostable proteins from hyperthermophiles like M. jannaschii, several critical considerations must be addressed:

  • Temperature stability of reagents and equipment:

    • Ensure all buffers, reagents, and equipment can withstand high temperatures

    • Consider using specialized high-temperature stable enzymes for molecular biology work

  • Appropriate controls:

    • Include proper temperature controls

    • Use both positive controls (known thermostable proteins) and negative controls (mesophilic proteins)

  • Statistical rigor:

    • Implement randomization to reduce selection bias

    • Use blinding for qualitative scoring to minimize observer bias

    • Consider factorial designs to maximize information from each experiment

  • Special assay considerations:

    • Account for temperature effects on reaction kinetics

    • Ensure protein stability throughout the experiment

    • Consider the effect of temperature on substrate availability and stability

A survey of experimental design quality found that only 12% of studies reported random allocation to treatment groups, and only 14% reported using blinding for qualitative assessments . These methodological considerations are particularly important when working with unusual proteins like MJ1161.

How can researchers validate predicted functions of MJ1161?

Validation of predicted functions requires multiple lines of evidence:

  • Biochemical validation:

    • In vitro enzymatic assays based on predicted function

    • Substrate specificity determination

    • Structure-function relationship studies

  • Genetic validation:

    • Gene knockout or knockdown studies in M. jannaschii using the newly developed genetic system

    • Complementation studies to confirm phenotypes

    • Site-directed mutagenesis of predicted functional residues

  • Structural validation:

    • Crystal structure determination

    • Comparison with structures of proteins of known function

    • Protein-ligand complex structures

  • Interactome studies:

    • Identification of protein interaction networks

    • Co-expression analysis

    • Localization studies

Case studies like those conducted with DNM2 protein demonstrate how two-way co-immunoprecipitation can confirm protein interactions, while inhibitor studies can validate functional relationships .

What evolutionary insights might be gained from functional characterization of MJ1161?

Functional characterization of MJ1161 could provide significant evolutionary insights:

  • Ancient metabolic pathways:

    • M. jannaschii performs one of the most ancient respiratory metabolisms on Earth (hydrogenotrophic methanogenesis)

    • MJ1161 may be involved in core metabolic processes conserved since early Earth

  • Adaptation to extreme environments:

    • Understanding how proteins like MJ1161 function in extreme conditions can reveal adaptations to high temperature, pressure, and anaerobic environments

    • These adaptations may represent ancient survival mechanisms

  • Minimal requirements for life:

    • M. jannaschii represents a minimal requirement for life to exist independently of other living systems

    • MJ1161 may be part of this minimal functional set

  • Comparative genomics:

    • Comparison with homologs in other archaea, bacteria, and eukaryotes can reveal evolutionary relationships

    • Horizontal gene transfer events may be identified

The characterization of MJ1161 could contribute to our understanding of early life on Earth and the evolution of fundamental biological processes, with potential implications for astrobiology and the search for life in extreme environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.