Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1210 (MJ1210)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ1210; Uncharacterized protein MJ1210
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1210
Target Protein Sequence
MMFMVKIITRKVKDIEPLENALLIEGLPGIGHVGRLAAEHLVHEFKGEKFLELFCYDFPP QVLVKDDGTIEYMCAEFYAIREPKPMIVVLGNTQALSPIGQYHLAEEIVKIGIEYGANFV YTLGGFGVGKLCEEVKVYGATTSKELAKKLKEHDILFRTDGGGIVGAAGLMLMFADLNGI PGICLMGETPGYLIDPNAAKAVLEKFCKLENIEINMEELEKRAKGMEQFIEKIKKFEEEM LKAAQAKPPSEEDLRYIG
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1210

STRING: 243232.MJ_1210

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is MJ1210 and what organism does it come from?

MJ1210 is an uncharacterized protein from the hyperthermophilic archaeon Methanocaldococcus jannaschii (formerly Methanococcus jannaschii). M. jannaschii was the first archaeon to have its complete genome sequenced, with a 1.66-megabase pair genome containing approximately 1,738 predicted protein-coding genes . The organism was originally isolated from a submarine hydrothermal vent at the East Pacific Rise, at a depth of 2600m, near a "white smoker" chimney off the western coast of Mexico .

What are the known physical characteristics of MJ1210?

MJ1210 is a full-length protein consisting of 258 amino acids. It can be produced recombinantly with a His-tag in E. coli expression systems, as shown in the table below :

Cat.#Product nameSource (Host)SpeciesTagProtein Length
RFL36661MFRecombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein MJ1210(MJ1210) Protein, His-TaggedE.coliMethanocaldococcus jannaschiiHisFull Length (1-258)

Why is M. jannaschii significant for protein research?

M. jannaschii is significant because it grows under extreme conditions (temperatures of 48-94°C with an optimum around 85°C, and pressures up to 500 atm) . Proteins from extremophiles like M. jannaschii often possess unique structural and functional properties that make them valuable for both basic research and biotechnological applications. The organism's proteins are often thermostable and have been the subject of extensive structural and functional studies, providing insights into archaeal metabolism and adaptation to extreme environments .

What are the optimal conditions for recombinant expression of MJ1210?

While specific expression conditions for MJ1210 are not directly reported in the provided literature, successful expression strategies for other M. jannaschii proteins can be applied. For thermophilic archaeal proteins like MJ1210, an experimental design approach using factorial designs is recommended. Based on research with other recombinant proteins, the following parameters should be optimized :

  • Expression host (E. coli BL21(DE3) is commonly used)

  • Expression vector (pET series vectors are often effective)

  • Induction temperature (typically 16-37°C, with lower temperatures often yielding more soluble protein)

  • Inducer concentration (IPTG, typically 0.1-1.0 mM)

  • Post-induction time (typically 4-16 hours)

  • Media composition (enriched media may improve yield)

A multivariant statistical experimental design allows simultaneous evaluation of multiple variables and their interactions to achieve optimal expression conditions .

What purification methods are effective for obtaining high-purity MJ1210?

Based on purification methods used for other M. jannaschii proteins such as MJ1225, a multi-step chromatography approach is recommended :

  • Immobilized Metal Affinity Chromatography (IMAC): Utilize the His-tag for initial purification with a Ni-NTA or similar column. Equilibrate with buffer containing HEPES pH 7.0, NaCl, EDTA, and β-mercaptoethanol, then elute with an imidazole gradient.

  • Ion Exchange Chromatography: Apply diluted protein from IMAC to a suitable ion exchange column based on the protein's theoretical pI.

  • Size Exclusion Chromatography: For final polishing, use a Superdex 75 or similar column with buffer containing HEPES pH 7.0, 200 mM NaCl, and 1 mM EDTA.

  • Verify Purity: Use SDS-PAGE and mass spectrometry to confirm identity and purity. For mass spectrometry analysis, in-gel tryptic digestion followed by MALDI-TOF analysis is recommended .

What crystallization conditions should be explored for MJ1210?

While specific crystallization conditions for MJ1210 have not been reported, successful approaches for other M. jannaschii proteins can guide initial screens. Based on the crystallization of MJ1225 :

  • Begin with commercial screening kits (Hampton Research Crystal Screens 1 and 2, PEG/Ion Screen, and SaltRX).

  • Use hanging-drop vapor-diffusion technique with 0.5 μl protein solution (80-160 mg/ml) and 0.5 μl reservoir solution.

  • For thermostable proteins from M. jannaschii, conditions containing ammonium sulfate (2.0-2.4 M), PEG 400 (2-3%), and buffers at pH 7.0-7.5 have proven successful.

  • Consider additives like detergents (e.g., FOS-choline) that may improve crystal quality.

  • Incubate at a constant temperature (typically 291 K).

Crystals should appear within 2-6 days if conditions are favorable .

What computational approaches can predict the structure and function of uncharacterized proteins like MJ1210?

For uncharacterized proteins like MJ1210, several computational approaches can provide structural and functional insights :

  • Profile-based sequence searches: Use Hidden Markov Models (HMMs) to detect remote homology relationships. These methods can identify distant relationships through the sequence space continuum.

  • Fold recognition methods: These approaches can associate uncharacterized proteins with known structural folds. For many domain families of unknown function (DUFs), associations have been made with common folds like Alpha-alpha superhelix, Transmembrane beta-barrels, TIM barrel, and Immunoglobulin-like beta-sandwich.

  • Designed protein-like sequences: These artificial sequences can serve as "linkers" to identify relationships between distant members of a structural fold, improving the sensitivity of homology searches.

  • Consensus methods: Employ multiple fold recognition methods to increase confidence in predictions when they agree on a particular fold association .

What experimental approaches can determine the function of uncharacterized proteins like MJ1210?

The COMBREX (COMputational BRidge to EXperiments) project suggests several approaches for experimentally characterizing uncharacterized proteins :

  • Biochemical assays based on predicted functions: Design experiments to test the most probable functions based on sequence similarity to characterized proteins.

  • Activity-based protein profiling: Use chemical probes to identify proteins with specific enzymatic activities.

  • Protein-protein interaction studies: Employ yeast two-hybrid, co-IP, or pull-down assays to identify interacting partners that may provide functional clues.

  • Metabolic profiling: Compare metabolite profiles between wild-type and knockout/overexpression strains.

  • Testing multiple similar proteins: Test several sequence-similar proteins to potentially delineate functional boundaries in sequence space, which improves follow-on predictions for many other proteins.

How can biological pathways involving MJ1210 be identified?

To identify biological pathways involving MJ1210, consider these approaches:

  • Genomic context analysis: Examine nearby genes in the M. jannaschii genome that might be functionally related.

  • Proteomics approaches: Use mass spectrometry to identify proteins that co-purify with MJ1210 or are differentially expressed in response to MJ1210 manipulation. Two-dimensional gel electrophoresis combined with mass spectrometry has been successfully used to identify M. jannaschii proteins .

  • Transcriptomics: Analyze gene expression patterns under different growth conditions to identify genes co-regulated with MJ1210.

  • Metabolic reconstructions: Examine gaps in known M. jannaschii metabolic pathways where MJ1210 might function, particularly focusing on pathways unique to archaea or methanogens .

How might MJ1210 contribute to the extremophilic properties of M. jannaschii?

This is a complex question requiring multiple investigative approaches:

  • Thermal stability analysis: Compare thermal denaturation profiles of MJ1210 with mesophilic homologs using differential scanning calorimetry or circular dichroism spectroscopy.

  • Pressure adaptation studies: Examine structural changes under high pressure using high-pressure X-ray crystallography or NMR.

  • Comparative genomics: Analyze the presence/absence of MJ1210 homologs across thermophilic and non-thermophilic archaea to identify correlations with growth temperature optima.

  • Structural analysis: Identify features associated with thermostability, such as increased hydrophobic packing, additional salt bridges, or disulfide bonds.

  • Growth experiments: Test whether MJ1210 expression levels change under different temperature and pressure conditions .

How can contradictory functional predictions for MJ1210 be experimentally resolved?

When facing contradictory functional predictions:

  • Design experiments to test multiple hypotheses simultaneously: Use substrate panels or multi-assay approaches that can detect different possible activities.

  • Structural studies combined with docking simulations: Crystal structures with various potential substrates can help identify the most likely function.

  • Mutagenesis of predicted key residues: Systematically mutate residues predicted to be important for each proposed function and assess effects on activity.

  • Heterologous expression studies: Express MJ1210 in different hosts where complementation of specific phenotypes can be tested.

  • Data integration approach: Use Bayesian methods to integrate results from multiple experimental approaches to resolve contradictory predictions .

What challenges exist in expressing archaeal proteins in bacterial systems and how can they be overcome?

Expression of archaeal proteins in bacterial systems presents several challenges:

  • Codon usage bias: M. jannaschii has different codon preferences than E. coli. Codon optimization of the MJ1210 gene sequence for E. coli expression can significantly improve protein yields.

  • Post-translational modifications: Archaea may have unique post-translational modifications that E. coli cannot reproduce. Consider using archaeal expression systems for proteins requiring specific modifications.

  • Protein folding at different temperatures: M. jannaschii proteins evolved to fold at high temperatures (85°C). Express at lower temperatures (15-20°C) to allow slower, more accurate folding.

  • Toxic effects on host: Use tightly regulated inducible systems and consider testing multiple E. coli strains designed for toxic protein expression.

  • Solubility issues: Co-express with archaeal chaperones or use fusion tags that enhance solubility (SUMO, MBP, or thioredoxin) .

What experimental design approach is recommended for optimizing MJ1210 expression?

A fractional factorial design is recommended for systematically optimizing expression conditions. The table below illustrates a potential experimental design with critical variables:

ExperimentTemperature (°C)IPTG (mM)Media TypeInduction OD₆₀₀Induction Time (h)Expression Level
1160.1LB0.64To be determined
2160.1TB1.016To be determined
3161.0LB1.04To be determined
4161.0TB0.616To be determined
5370.1LB1.016To be determined
6370.1TB0.64To be determined
7371.0LB0.616To be determined
8371.0TB1.04To be determined

This multivariant approach allows evaluation of main effects and interactions between variables with fewer experiments than a full factorial design .

What are the key parameters to monitor during MJ1210 purification process development?

During purification process development, monitoring these key parameters will help optimize yield and purity:

Regular monitoring of these parameters throughout purification will guide decision-making and troubleshooting efforts .

What is currently known about the protein interactome of MJ1210?

While specific interacting partners of MJ1210 have not been reported in the provided literature, approaches to identify its interactome could include:

  • Pull-down assays: Using the His-tagged recombinant MJ1210 as bait to identify interacting proteins from M. jannaschii lysates.

  • Yeast two-hybrid screens: Though challenging for archaeal proteins, this approach has been adapted for extremophilic proteins.

  • Protein microarrays: Probing arrays containing M. jannaschii proteins with labeled MJ1210.

  • In silico prediction: Using computational methods to predict interactions based on sequence and structural features.

The protein interactome would provide valuable insights into the functional role of MJ1210 in cellular processes .

How might research on uncharacterized proteins like MJ1210 contribute to understanding archaeal evolution?

Research on uncharacterized proteins like MJ1210 can provide significant insights into archaeal evolution:

  • Identification of archaeal-specific functions: Many uncharacterized proteins in archaea may represent novel functions not present in bacteria or eukaryotes.

  • Understanding adaptation to extreme environments: Proteins specific to thermophilic archaea may reveal molecular mechanisms of adaptation to high temperatures and pressures.

  • Reconstruction of metabolic capabilities: Characterizing all proteins in the proteome allows complete metabolic reconstruction, revealing unique archaeal pathways.

  • Horizontal gene transfer events: Identifying the evolutionary origin of proteins like MJ1210 can reveal instances of horizontal gene transfer between domains.

  • Molecular fossils: Some archaeal proteins may represent ancient functions dating back to the last universal common ancestor (LUCA) .

Fully characterizing the archaeal proteome, including MJ1210, provides a more complete picture of the diversity and evolution of life on Earth.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.