MJ1219 is a recombinant protein derived from Methanocaldococcus jannaschii, expressed in E. coli with an N-terminal His-tag for purification . Key characteristics include:
The His-tag facilitates affinity chromatography for isolation .
Recombinant production in E. coli may introduce structural artifacts due to differing folding environments .
Hydrophobicity: The sequence includes hydrophobic stretches (e.g., "LLGYNYYTGNIFCGVIGSLLLFGALWSLNGGKIWGIISFI"), suggesting possible transmembrane domains .
Motifs: No conserved catalytic motifs (e.g., ATP-binding, redox-active sites) are identifiable from primary sequence analysis .
| Feature | Observation |
|---|---|
| Transmembrane Potential | Predicted via sequence hydrophobicity |
| Post-Translational Modifications | None experimentally confirmed |
Locus: MJ1219 is part of the M. jannaschii chromosome (NC_000909) .
Orthologs: Limited to methanococcales; no eukaryotic homologs identified .
MJ1219’s recombinant form serves as a reagent in archaeological and biochemical studies:
Annotation Gaps: ~33% of M. jannaschii genes, including MJ1219, remain uncharacterized .
Host Limitations: E. coli may misfold archaeal proteins, complicating functional assays .
Commercially available MJ1219 preparations vary in formulation and intended use:
Functional Studies:
Structural Determination:
Prioritize MJ1219 for X-ray crystallography or cryo-EM to resolve tertiary structure.
Pathway Integration:
KEGG: mja:MJ_1219
STRING: 243232.MJ_1219
Recombinant MJ1219 protein is typically supplied as a lyophilized powder and requires careful handling to maintain structural integrity and functionality. For optimal stability, the protein should be stored at -20°C to -80°C upon receipt . The recommended storage buffer consists of a Tris/PBS-based solution with 6% trehalose at pH 8.0 .
When reconstituting the protein, it should be briefly centrifuged prior to opening to ensure all material is at the bottom of the vial. Reconstitution should be performed using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . For long-term storage, adding glycerol to a final concentration of 5-50% (typically 50%) and aliquoting before storing at -20°C/-80°C is recommended to prevent damage from freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided as it can compromise protein integrity .
When documenting experimental work with MJ1219, data should be organized in clear, comprehensive tables that follow scientific best practices. A well-structured data table should include:
| Component | Description |
|---|---|
| Title | Descriptive heading relating to the specific data collected, not just repeating the research question |
| Column Headers | Clear labels including units and measurement uncertainty |
| Manipulated Variable | Typically placed in the leftmost column |
| Raw Data | Organized in columns with consistent significant digits |
| Processed Data | Averages, standard deviations, or other calculations in the rightmost columns |
The information in data tables must be immediately clear to any reader, with consistent precision across all numerical values . Each cell should contain a value, and there should be no variation in the precision of the data (same number of decimal places throughout) . This organization is particularly important when documenting expression yields, purification efficiency, or activity assays for MJ1219.
The most commonly used expression system for MJ1219 is Escherichia coli, which offers a balance of yield and simplicity . When expressing archaeal membrane proteins like MJ1219 in bacterial systems, several considerations become critical:
Codon optimization may be necessary due to the difference in codon usage between archaea and bacteria
Expression temperature often needs to be lowered (typically to 18-25°C) to allow proper folding
Specialized E. coli strains designed for membrane protein expression may yield better results
Commercial preparations of MJ1219 typically use E. coli as the expression host with an N-terminal His-tag for purification . For researchers performing their own expression, it's advisable to test multiple strains and induction conditions, as membrane proteins from extremophiles can be challenging to express in functional form.
The optimal expression conditions can be determined using Design of Experiments (DoE) approaches rather than the inefficient one-factor-at-a-time method . DoE allows researchers to evaluate multiple variables simultaneously (temperature, inducer concentration, media composition, etc.) to identify optimal expression conditions with fewer experiments .
Purifying MJ1219 presents several challenges typical of membrane proteins:
Solubilization: As a predicted membrane protein, MJ1219 requires careful selection of detergents for extraction from membranes. A systematic screening of detergents is recommended, starting with mild non-ionic detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol).
Affinity Purification: While His-tagged versions facilitate purification using immobilized metal affinity chromatography (IMAC) , optimization of imidazole concentrations is critical - too low concentrations result in contaminants, while too high may cause protein aggregation.
Protein Stability: Throughout purification, maintaining protein stability is crucial. Addition of glycerol (5-10%) and appropriate salt concentrations in all buffers can help prevent aggregation.
A typical purification workflow involves:
| Step | Method | Critical Parameters |
|---|---|---|
| 1 | Cell lysis | Gentle lysis methods to preserve membrane integrity |
| 2 | Membrane isolation | Ultracentrifugation to separate membranes |
| 3 | Solubilization | Optimized detergent concentration and buffer composition |
| 4 | IMAC | Gradient elution with imidazole |
| 5 | Size exclusion | Assessment of oligomeric state and homogeneity |
Purity assessment via SDS-PAGE typically shows MJ1219 preparations with >90% purity after optimized purification protocols .
As an uncharacterized protein, bioinformatic approaches provide valuable insights into potential MJ1219 functions. Several complementary methods can be employed:
Sequence Homology Analysis: While sequence homology alone may be insufficient for MJ1219 due to its uniqueness, distant homologs might be identified using sensitive methods like PSI-BLAST or HHpred.
Structural Prediction: AlphaFold2 and similar tools can generate structural models that may reveal functional sites or structural similarity to characterized proteins.
Co-evolution Analysis: Examining evolutionary patterns across multiple species can identify residues that co-evolve, suggesting functional importance.
Genomic Context Analysis: Examining neighboring genes in the M. jannaschii genome may provide clues about functional associations.
Co-essentiality Networks: Recent advances in genomic screening have enabled the creation of co-essentiality networks that can assign functions to uncharacterized genes based on their essentiality profiles across cell lines . These networks have successfully predicted functions for over 100 previously uncharacterized genes .
When applying these approaches to MJ1219, researchers should integrate multiple lines of evidence rather than relying on a single method, as each has inherent limitations when applied to archaeal proteins with limited homology to well-characterized systems.
Co-essentiality profiling represents a powerful approach for functional prediction of uncharacterized proteins like MJ1219. This method analyzes patterns of gene essentiality across hundreds of cell lines to identify genes that share similar essentiality profiles, suggesting they function in related pathways .
While this approach has primarily been applied to eukaryotic systems, the principles can be adapted for archaeal proteins through comparative genomics:
Identify proteins that consistently co-occur with MJ1219 across archaeal genomes
Examine conservation patterns in related extremophiles
Look for genomic clustering that might indicate functional relationships
The genome-wide atlas of co-essential modules has successfully assigned functions to 108 previously uncharacterized genes in human systems . Similar approaches could be adapted for archaeal systems to provide insights into MJ1219 function.
For example, if MJ1219 consistently co-occurs with proteins involved in membrane transport or stress response across multiple archaeal species, this would provide testable hypotheses about its function. Researchers could then design targeted experiments to validate these predictions.
M. jannaschii is a hyperthermophilic methanogen that grows optimally at temperatures around 85°C and pressures exceeding 200 atm. As a predicted membrane protein from this organism, MJ1219 may play a role in the exceptional membrane adaptations required for survival in these extreme conditions.
Research approaches to explore this include:
Comparative studies between MJ1219 and homologs from mesophilic archaea to identify thermostability determinants.
Lipid interaction analysis to determine if MJ1219 has specific interactions with archaeal lipids, which differ fundamentally from bacterial and eukaryotic membrane lipids.
Pressure-dependent functional assays to assess if MJ1219 plays a role in pressure adaptation.
Temperature-dependent structural studies to examine conformational changes and stability at different temperatures.
The high proportion of glycine residues in MJ1219 (visible in its sequence) may provide flexibility needed for function under extreme conditions . Additionally, the hydrophobic nature of many segments suggests multiple membrane-spanning domains that could contribute to membrane stability or transport functions in extreme environments.
Identifying interaction partners is crucial for understanding the function of uncharacterized proteins. For MJ1219, several approaches are applicable:
Pull-down assays using His-tagged MJ1219 as bait to capture interacting partners from M. jannaschii lysates.
Bacterial/Archaeal two-hybrid systems adapted for high-temperature organisms to detect protein-protein interactions.
Crosslinking mass spectrometry to identify proteins in proximity to MJ1219 in native membranes.
Co-immunoprecipitation studies similar to those performed for other proteins can reveal stable protein complexes .
When performing these experiments, it's essential to include appropriate controls. For example, in pull-down experiments, researchers should use a non-specific tagged protein as a negative control to identify non-specific binding. As demonstrated in other protein interaction studies, two-way co-immunoprecipitation provides more reliable evidence of specific interactions .
Structural characterization of MJ1219 presents several challenges typical of membrane proteins from extremophiles:
Low expression yields: This can be addressed through systematic optimization of expression conditions using DoE approaches , which allow for efficient testing of multiple parameters simultaneously rather than changing one factor at a time.
Protein instability during purification: Stabilizing additives like specific lipids, glycerol, or salt concentrations can be screened systematically.
Detergent selection: Detergents must effectively solubilize the protein while maintaining its native structure. A screening approach testing multiple detergents is recommended:
| Detergent Class | Examples to Test | Advantages | Disadvantages |
|---|---|---|---|
| Non-ionic | DDM, DM, OG | Mild, maintain protein stability | May not fully solubilize |
| Zwitterionic | LDAO, FC-12 | Effective solubilization | Potentially denaturing |
| Polymeric | Amphipols, nanodiscs | Detergent-free analysis | Complex preparation |
Crystallization challenges: Membrane proteins are notoriously difficult to crystallize. Techniques like lipidic cubic phase crystallization or electron microscopy may be more successful than traditional vapor diffusion methods.
When troubleshooting expression and purification issues, a systematic approach is essential. The Design of Experiments (DoE) methodology allows researchers to efficiently optimize multiple parameters simultaneously, reducing the time and resources needed to establish successful protocols .
When different computational approaches predict conflicting functions for MJ1219, researchers should:
Evaluate prediction confidence: Assess the statistical strength and confidence levels of each prediction.
Consider evolutionary conservation: Prioritize predictions involving highly conserved residues or domains.
Design discriminatory experiments: Develop experiments specifically designed to distinguish between competing functional hypotheses.
Integrate multiple data types: Combine structural, genomic, and biochemical data to build a more comprehensive functional model.
Consider multifunctionality: MJ1219 may perform different functions under different conditions or have multiple roles within the cell.
The integrated approach used in genome-wide functional studies demonstrates that combining multiple lines of evidence provides more reliable functional predictions than any single method . When applied to uncharacterized proteins like MJ1219, this principle becomes even more important due to the limited reference data available for archaeal proteins.