Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1219 (MJ1219)

Shipped with Ice Packs
In Stock

Description

Defining Recombinant MJ1219

MJ1219 is a recombinant protein derived from Methanocaldococcus jannaschii, expressed in E. coli with an N-terminal His-tag for purification . Key characteristics include:

PropertySpecification
Protein LengthFull-length (1–104 amino acids)
Molecular Weight~11.5 kDa
Amino Acid SequenceMVNMAPNTNFASLVAVAGCVLLGYNYYTGNIFCGVIGSLLLFGALWSLNGGKIWGIISFIISASIFCYINWDFILNLLFYSIIAFIVMSILILIFGNNRGGYYY
Purity>90% (SDS-PAGE)
FormLyophilized powder or liquid with glycerol
Storage-20°C/-80°C long-term; 4°C for short-term aliquots

Notes:

  • The His-tag facilitates affinity chromatography for isolation .

  • Recombinant production in E. coli may introduce structural artifacts due to differing folding environments .

Sequence and Topological Features

  • Hydrophobicity: The sequence includes hydrophobic stretches (e.g., "LLGYNYYTGNIFCGVIGSLLLFGALWSLNGGKIWGIISFI"), suggesting possible transmembrane domains .

  • Motifs: No conserved catalytic motifs (e.g., ATP-binding, redox-active sites) are identifiable from primary sequence analysis .

FeatureObservation
Transmembrane PotentialPredicted via sequence hydrophobicity
Post-Translational ModificationsNone experimentally confirmed

Genomic Context

  • Locus: MJ1219 is part of the M. jannaschii chromosome (NC_000909) .

  • Orthologs: Limited to methanococcales; no eukaryotic homologs identified .

Research Applications and Experimental Tools

MJ1219’s recombinant form serves as a reagent in archaeological and biochemical studies:

Experimental Uses

ApplicationDetails
ELISA DevelopmentUsed as an antigen in immunoassays for antibody production
Protein Interaction StudiesCandidate for co-IP/pull-down assays to identify binding partners (no data publicly available)
Structural BiologyTemplate for crystallization or cryo-EM studies (no resolved structures reported)

Challenges in Functional Elucidation

  • Annotation Gaps: ~33% of M. jannaschii genes, including MJ1219, remain uncharacterized .

  • Host Limitations: E. coli may misfold archaeal proteins, complicating functional assays .

Comparative Analysis of Recombinant MJ1219 Products

Commercially available MJ1219 preparations vary in formulation and intended use:

SupplierProduct IDFormPurityApplications
Creative BioMartRFL32120MFLyophilized powder>90%General research
MyBioSourceMBS7038524Liquid (glycerol)>85%ELISA, interaction studies
AnagnosticsCSB-CF710411MRUPurified proteinN/AELISA assays

Future Directions

  1. Functional Studies:

    • Biochemical Assays: Test enzymatic activity (e.g., hydrolase, transferase) using archaeal cofactors (e.g., F420) .

    • Genetic Knockouts: Utilize M. jannaschii genetic tools to assess phenotypic effects of MJ1219 deletion .

  2. Structural Determination:

    • Prioritize MJ1219 for X-ray crystallography or cryo-EM to resolve tertiary structure.

  3. Pathway Integration:

    • Cross-reference with MjCyc (BioCyc.org) to identify potential metabolic or regulatory roles .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific requirement for the format, please indicate it in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ1219; Uncharacterized protein MJ1219
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1219
Target Protein Sequence
MVNMAPNTNFASLVAVAGCVLLGYNYYTGNIFCGVIGSLLLFGALWSLNGGKIWGIISFI ISASIFCYINWDFILNLLFYSIIAFIVMSILILIFGNNRGGYYY
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1219

STRING: 243232.MJ_1219

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant MJ1219?

Recombinant MJ1219 protein is typically supplied as a lyophilized powder and requires careful handling to maintain structural integrity and functionality. For optimal stability, the protein should be stored at -20°C to -80°C upon receipt . The recommended storage buffer consists of a Tris/PBS-based solution with 6% trehalose at pH 8.0 .

When reconstituting the protein, it should be briefly centrifuged prior to opening to ensure all material is at the bottom of the vial. Reconstitution should be performed using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . For long-term storage, adding glycerol to a final concentration of 5-50% (typically 50%) and aliquoting before storing at -20°C/-80°C is recommended to prevent damage from freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided as it can compromise protein integrity .

How should experimental data for MJ1219 be organized and presented?

When documenting experimental work with MJ1219, data should be organized in clear, comprehensive tables that follow scientific best practices. A well-structured data table should include:

ComponentDescription
TitleDescriptive heading relating to the specific data collected, not just repeating the research question
Column HeadersClear labels including units and measurement uncertainty
Manipulated VariableTypically placed in the leftmost column
Raw DataOrganized in columns with consistent significant digits
Processed DataAverages, standard deviations, or other calculations in the rightmost columns

The information in data tables must be immediately clear to any reader, with consistent precision across all numerical values . Each cell should contain a value, and there should be no variation in the precision of the data (same number of decimal places throughout) . This organization is particularly important when documenting expression yields, purification efficiency, or activity assays for MJ1219.

What expression systems are most effective for recombinant MJ1219 production?

The most commonly used expression system for MJ1219 is Escherichia coli, which offers a balance of yield and simplicity . When expressing archaeal membrane proteins like MJ1219 in bacterial systems, several considerations become critical:

  • Codon optimization may be necessary due to the difference in codon usage between archaea and bacteria

  • Expression temperature often needs to be lowered (typically to 18-25°C) to allow proper folding

  • Specialized E. coli strains designed for membrane protein expression may yield better results

Commercial preparations of MJ1219 typically use E. coli as the expression host with an N-terminal His-tag for purification . For researchers performing their own expression, it's advisable to test multiple strains and induction conditions, as membrane proteins from extremophiles can be challenging to express in functional form.

The optimal expression conditions can be determined using Design of Experiments (DoE) approaches rather than the inefficient one-factor-at-a-time method . DoE allows researchers to evaluate multiple variables simultaneously (temperature, inducer concentration, media composition, etc.) to identify optimal expression conditions with fewer experiments .

What purification challenges are specific to MJ1219 and how can they be addressed?

Purifying MJ1219 presents several challenges typical of membrane proteins:

  • Solubilization: As a predicted membrane protein, MJ1219 requires careful selection of detergents for extraction from membranes. A systematic screening of detergents is recommended, starting with mild non-ionic detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol).

  • Affinity Purification: While His-tagged versions facilitate purification using immobilized metal affinity chromatography (IMAC) , optimization of imidazole concentrations is critical - too low concentrations result in contaminants, while too high may cause protein aggregation.

  • Protein Stability: Throughout purification, maintaining protein stability is crucial. Addition of glycerol (5-10%) and appropriate salt concentrations in all buffers can help prevent aggregation.

A typical purification workflow involves:

StepMethodCritical Parameters
1Cell lysisGentle lysis methods to preserve membrane integrity
2Membrane isolationUltracentrifugation to separate membranes
3SolubilizationOptimized detergent concentration and buffer composition
4IMACGradient elution with imidazole
5Size exclusionAssessment of oligomeric state and homogeneity

Purity assessment via SDS-PAGE typically shows MJ1219 preparations with >90% purity after optimized purification protocols .

What computational approaches can predict potential functions of MJ1219?

As an uncharacterized protein, bioinformatic approaches provide valuable insights into potential MJ1219 functions. Several complementary methods can be employed:

  • Sequence Homology Analysis: While sequence homology alone may be insufficient for MJ1219 due to its uniqueness, distant homologs might be identified using sensitive methods like PSI-BLAST or HHpred.

  • Structural Prediction: AlphaFold2 and similar tools can generate structural models that may reveal functional sites or structural similarity to characterized proteins.

  • Co-evolution Analysis: Examining evolutionary patterns across multiple species can identify residues that co-evolve, suggesting functional importance.

  • Genomic Context Analysis: Examining neighboring genes in the M. jannaschii genome may provide clues about functional associations.

  • Co-essentiality Networks: Recent advances in genomic screening have enabled the creation of co-essentiality networks that can assign functions to uncharacterized genes based on their essentiality profiles across cell lines . These networks have successfully predicted functions for over 100 previously uncharacterized genes .

When applying these approaches to MJ1219, researchers should integrate multiple lines of evidence rather than relying on a single method, as each has inherent limitations when applied to archaeal proteins with limited homology to well-characterized systems.

How can co-essentiality profiling be applied to understand MJ1219 function?

Co-essentiality profiling represents a powerful approach for functional prediction of uncharacterized proteins like MJ1219. This method analyzes patterns of gene essentiality across hundreds of cell lines to identify genes that share similar essentiality profiles, suggesting they function in related pathways .

While this approach has primarily been applied to eukaryotic systems, the principles can be adapted for archaeal proteins through comparative genomics:

  • Identify proteins that consistently co-occur with MJ1219 across archaeal genomes

  • Examine conservation patterns in related extremophiles

  • Look for genomic clustering that might indicate functional relationships

The genome-wide atlas of co-essential modules has successfully assigned functions to 108 previously uncharacterized genes in human systems . Similar approaches could be adapted for archaeal systems to provide insights into MJ1219 function.

For example, if MJ1219 consistently co-occurs with proteins involved in membrane transport or stress response across multiple archaeal species, this would provide testable hypotheses about its function. Researchers could then design targeted experiments to validate these predictions.

How can MJ1219 contribute to understanding archaeal membrane adaptations to extreme environments?

M. jannaschii is a hyperthermophilic methanogen that grows optimally at temperatures around 85°C and pressures exceeding 200 atm. As a predicted membrane protein from this organism, MJ1219 may play a role in the exceptional membrane adaptations required for survival in these extreme conditions.

Research approaches to explore this include:

  • Comparative studies between MJ1219 and homologs from mesophilic archaea to identify thermostability determinants.

  • Lipid interaction analysis to determine if MJ1219 has specific interactions with archaeal lipids, which differ fundamentally from bacterial and eukaryotic membrane lipids.

  • Pressure-dependent functional assays to assess if MJ1219 plays a role in pressure adaptation.

  • Temperature-dependent structural studies to examine conformational changes and stability at different temperatures.

The high proportion of glycine residues in MJ1219 (visible in its sequence) may provide flexibility needed for function under extreme conditions . Additionally, the hydrophobic nature of many segments suggests multiple membrane-spanning domains that could contribute to membrane stability or transport functions in extreme environments.

What experimental approaches are suitable for determining MJ1219 interaction partners?

Identifying interaction partners is crucial for understanding the function of uncharacterized proteins. For MJ1219, several approaches are applicable:

  • Pull-down assays using His-tagged MJ1219 as bait to capture interacting partners from M. jannaschii lysates.

  • Bacterial/Archaeal two-hybrid systems adapted for high-temperature organisms to detect protein-protein interactions.

  • Crosslinking mass spectrometry to identify proteins in proximity to MJ1219 in native membranes.

  • Co-immunoprecipitation studies similar to those performed for other proteins can reveal stable protein complexes .

When performing these experiments, it's essential to include appropriate controls. For example, in pull-down experiments, researchers should use a non-specific tagged protein as a negative control to identify non-specific binding. As demonstrated in other protein interaction studies, two-way co-immunoprecipitation provides more reliable evidence of specific interactions .

What are common challenges in structural studies of MJ1219 and how can they be addressed?

Structural characterization of MJ1219 presents several challenges typical of membrane proteins from extremophiles:

  • Low expression yields: This can be addressed through systematic optimization of expression conditions using DoE approaches , which allow for efficient testing of multiple parameters simultaneously rather than changing one factor at a time.

  • Protein instability during purification: Stabilizing additives like specific lipids, glycerol, or salt concentrations can be screened systematically.

  • Detergent selection: Detergents must effectively solubilize the protein while maintaining its native structure. A screening approach testing multiple detergents is recommended:

Detergent ClassExamples to TestAdvantagesDisadvantages
Non-ionicDDM, DM, OGMild, maintain protein stabilityMay not fully solubilize
ZwitterionicLDAO, FC-12Effective solubilizationPotentially denaturing
PolymericAmphipols, nanodiscsDetergent-free analysisComplex preparation
  • Crystallization challenges: Membrane proteins are notoriously difficult to crystallize. Techniques like lipidic cubic phase crystallization or electron microscopy may be more successful than traditional vapor diffusion methods.

When troubleshooting expression and purification issues, a systematic approach is essential. The Design of Experiments (DoE) methodology allows researchers to efficiently optimize multiple parameters simultaneously, reducing the time and resources needed to establish successful protocols .

How should conflicting functional predictions for MJ1219 be reconciled?

When different computational approaches predict conflicting functions for MJ1219, researchers should:

  • Evaluate prediction confidence: Assess the statistical strength and confidence levels of each prediction.

  • Consider evolutionary conservation: Prioritize predictions involving highly conserved residues or domains.

  • Design discriminatory experiments: Develop experiments specifically designed to distinguish between competing functional hypotheses.

  • Integrate multiple data types: Combine structural, genomic, and biochemical data to build a more comprehensive functional model.

  • Consider multifunctionality: MJ1219 may perform different functions under different conditions or have multiple roles within the cell.

The integrated approach used in genome-wide functional studies demonstrates that combining multiple lines of evidence provides more reliable functional predictions than any single method . When applied to uncharacterized proteins like MJ1219, this principle becomes even more important due to the limited reference data available for archaeal proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.