Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1280 (MJ1280)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
MJ1280; Uncharacterized protein MJ1280
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1280
Target Protein Sequence
MNLILTLLIIFAIIGLLILIFGIWLIKKLLFPKKKPKPYQVRHGSSSSKRGYGSHDVYHH HYVTKDVYVHDYGDDDIYDERGKKEGDKDDSLIDKAIAFGAGAVTGYGVAEYGEEIKEEV EDIVKEGEDIIDDIVEEAEDFVEDVVDDFDNGGDDDY
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1280

STRING: 243232.MJ_1280

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant in protein research?

Methanocaldococcus jannaschii is a hyperthermophilic methanogenic archaeon that thrives in extreme environments, particularly hydrothermal vents with temperatures exceeding 80°C. This organism has significant research importance because it represents one of the phylogenetically deeply rooted methanogens, offering insights into early evolutionary biology and adaptations to extreme conditions. The proteins from M. jannaschii, including uncharacterized ones like MJ1280, are of particular interest because they often possess unusual stability at high temperatures and unique structural properties that can inform protein engineering. Studies on M. jannaschii have contributed substantially to our understanding of archaeal genetics, metabolism, and the molecular basis of thermostability in proteins .

What expression systems are typically used for producing recombinant M. jannaschii proteins?

Recombinant M. jannaschii proteins, including MJ1280, are typically expressed using E. coli-based systems due to their efficiency and scalability. For example, MJ1280 has been successfully expressed as a His-tagged recombinant protein in E. coli . When working with archaeal proteins like those from M. jannaschii, researchers often need to address codon usage bias by incorporating rare tRNA genes into the expression system, similar to the approach used for other M. jannaschii proteins where the pRI952 plasmid containing the argU and ileX tRNA genes is employed to accommodate codons that are rare in E. coli . Purification commonly involves affinity chromatography, taking advantage of tags such as the histidine tag, which allows for efficient one-step purification of the target protein. Alternative expression systems that have been explored for archaeal proteins include yeast and insect cell systems, though E. coli remains the predominant choice for initial characterization studies.

What are the common challenges in working with uncharacterized proteins from hyperthermophiles?

Working with uncharacterized proteins like MJ1280 from hyperthermophiles presents several distinct challenges. First, maintaining the native folding and activity during recombinant expression can be difficult since the optimal conditions for M. jannaschii proteins (high temperature, often anaerobic environments) differ significantly from standard laboratory conditions. Second, the development of appropriate functional assays is complicated by the lack of known activities or homologies to well-characterized proteins. Third, crystallization for structural studies may require special conditions to accommodate the unique properties of hyperthermophilic proteins. Additionally, researchers often encounter issues with protein solubility and aggregation during expression and purification, which may require optimization of buffer systems to include stabilizing agents . Another significant challenge is the potential oxygen sensitivity of proteins from strictly anaerobic organisms like M. jannaschii, necessitating oxygen-free handling procedures similar to those described for other M. jannaschii proteins .

What bioinformatic approaches can help predict the function of uncharacterized proteins like MJ1280?

Bioinformatic approaches offer valuable insights into uncharacterized proteins like MJ1280. Sequence comparison tools such as BLAST can identify homologs across species, potentially revealing evolutionary relationships and functional hints. Structural prediction algorithms (including AlphaFold) can generate theoretical models based on amino acid sequences, providing insights into potential active sites and binding domains. Domain recognition tools may identify conserved functional domains within the protein sequence. Phylogenetic analysis can place MJ1280 in an evolutionary context, potentially revealing relationships to proteins with known functions, similar to analyses performed for other M. jannaschii proteins like FprA homologs . Gene neighborhood analysis examines genes adjacent to MJ1280 in the genome, which might participate in the same biochemical pathway. Transcriptomic data analysis can reveal co-expressed genes, providing clues about functional associations, as demonstrated in studies of other M. jannaschii genes that revealed whether they are transcribed as monocistronic or polycistronic mRNAs . Together, these approaches can guide experimental design by generating testable hypotheses about protein function.

What purification strategies are effective for thermostable archaeal proteins?

Purification of thermostable archaeal proteins like MJ1280 often takes advantage of their inherent heat stability. A commonly employed strategy is heat treatment of cell lysates (70-80°C for 15-30 minutes), which denatures most E. coli host proteins while leaving the thermostable archaeal protein intact, providing a simple initial purification step. Affinity chromatography, particularly using His-tags as reported for recombinant MJ1280, allows for efficient isolation of the target protein . Ion exchange chromatography is useful for further purification, especially considering the often unique charge distribution of archaeal proteins. Size exclusion chromatography serves as a polishing step to remove aggregates and achieve high purity. Buffer optimization is crucial and typically includes stabilizing agents like glycerol or specific salt concentrations; for instance, purification buffers for other M. jannaschii proteins have included components such as 10% glycerol, DTT, and ammonium sulfate . Additionally, researchers must consider whether anaerobic conditions are necessary during purification, especially for proteins from strict anaerobes like M. jannaschii.

How can genetic manipulation systems for M. jannaschii facilitate functional studies of uncharacterized proteins?

Genetic manipulation systems for M. jannaschii represent a significant advancement in studying archaeal proteins like MJ1280 in their native context. These systems, such as the one described for M. jannaschii, typically employ suicide plasmids containing homologous regions that facilitate double crossover recombination with the chromosome . For uncharacterized proteins like MJ1280, this approach allows for gene knockout, modification, or tagging studies directly within the organism. Researchers can design constructs similar to pDS261, which contained upstream and coding region elements of the target gene to enable homologous recombination . This technology enables the introduction of affinity tags (such as FLAG or Strep tags) to the native protein, facilitating both localization studies and purification from the native organism. Gene knockout studies can reveal phenotypic changes that provide functional insights, while promoter modifications can help understand expression patterns and regulation. Complementation studies, where mutant phenotypes are rescued by reintroducing the wild-type gene, can confirm gene function assignments. These approaches are particularly valuable for proteins like MJ1280 where heterologous expression might not fully recapitulate native folding or post-translational modifications that occur in the hyperthermophilic archaeal environment.

What techniques can resolve the structural characteristics of thermostable proteins from hyperthermophiles?

Resolving the structural characteristics of thermostable proteins like MJ1280 requires specialized techniques that can accommodate their unique properties. X-ray crystallography remains a gold standard for high-resolution structural determination, as demonstrated for other M. jannaschii proteins . Successful crystallization often requires screening numerous conditions with various precipitants, buffers, and additives specific to thermostable proteins. Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative that doesn't require crystallization, particularly valuable for proteins resistant to crystallization. Nuclear Magnetic Resonance (NMR) spectroscopy can provide structural information for smaller proteins (like MJ1280 at 157 amino acids) in solution, potentially revealing dynamic aspects of the protein structure. Small-angle X-ray scattering (SAXS) offers lower-resolution structural information but can analyze proteins in solution under various conditions, including high temperatures that mimic the native environment. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide insights into protein dynamics and solvent accessibility. Circular dichroism spectroscopy helps determine secondary structure content and thermal stability, particularly relevant for hyperthermophilic proteins. Often, researchers employ a combination of these techniques to develop comprehensive structural models, as was done for the DEAD box protein from M. jannaschii .

How do you establish functional assays for proteins with no known catalytic activity or structural homologs?

Establishing functional assays for uncharacterized proteins like MJ1280 without known catalytic activities or structural homologs requires a strategic, multifaceted approach. Activity-based protein profiling uses chemical probes that react with specific functional groups, potentially revealing enzymatic activities. High-throughput substrate screening exposes the protein to diverse potential substrates (metabolites, nucleic acids, etc.) while monitoring for biochemical changes. Thermal shift assays can identify binding partners based on changes in protein stability upon ligand interaction. Protein-protein interaction studies using techniques like pull-downs, yeast two-hybrid, or proximity labeling may reveal binding partners that provide functional context. Co-expression analysis identifies genes with correlated expression patterns, suggesting functional relationships. Comparative phylogenetic profiling examines the co-occurrence of genes across species, indicating potential functional associations. For instance, when characterizing the FprA protein from M. jannaschii, researchers leveraged knowledge from homologous proteins in related organisms to establish an F420H2 oxidase activity assay . Metabolomic approaches can identify changes in metabolite profiles when the protein is present versus absent. Systematic phenotypic analysis following gene disruption can reveal physiological roles. These approaches often work iteratively, with initial findings guiding more focused subsequent experiments.

What are the methodological considerations for analyzing protein-protein interactions in hyperthermophilic systems?

Analyzing protein-protein interactions (PPIs) for hyperthermophilic proteins like MJ1280 presents unique methodological challenges that require specialized approaches. Traditional pull-down assays must be modified to accommodate the stability requirements of thermophilic proteins, with buffer systems that maintain protein integrity at higher temperatures. Crosslinking mass spectrometry can capture interactions in near-native conditions and is particularly valuable for thermophilic proteins as the crosslinking reaction often proceeds more efficiently at elevated temperatures. Surface plasmon resonance and isothermal titration calorimetry need to be conducted at temperatures relevant to the native environment of M. jannaschii (80-85°C), requiring specialized equipment modifications. For in vivo studies, bacterial or yeast two-hybrid systems require adaptation for thermophilic proteins, potentially using thermotolerant host strains. Chemical crosslinking followed by mass spectrometry can map interaction interfaces, providing structural insights into the complex. Importantly, researchers must consider that PPIs observed at standard laboratory temperatures may not reflect the interactions occurring in the native hyperthermophilic environment. The binding kinetics and thermodynamics likely differ significantly at elevated temperatures, necessitating temperature-dependent interaction studies. Additionally, the cellular context of M. jannaschii, including its unique membrane composition and cytoplasmic environment, may influence protein interactions in ways that are difficult to replicate in heterologous systems.

How can contradictory experimental results from different expression systems be reconciled when studying archaeal proteins?

Reconciling contradictory experimental results from different expression systems is a complex challenge when studying archaeal proteins like MJ1280. The first step involves systematic comparison of expression conditions across systems, documenting differences in tags, fusion partners, and expression temperatures. Protein characterization techniques, including circular dichroism, thermal shift assays, and limited proteolysis, can assess whether the protein adopts the same fold across different expression systems. Activity assays should be standardized and performed under identical conditions to determine if functional differences reflect true biological variation or are artifacts of the expression system. Post-translational modifications should be characterized via mass spectrometry, as different expression systems may yield different modification patterns that affect function. For archaeal proteins, codon optimization strategies may differ between expression systems, potentially affecting translation efficiency and protein folding. The cellular environment, including chaperone availability and redox conditions, varies significantly between expression hosts and may impact protein folding and activity. For instance, when working with proteins like those from M. jannaschii, researchers need to consider whether rare codons require supplementation with specific tRNA genes, as was done for other M. jannaschii proteins using the pRI952 plasmid containing the argU and ileX tRNA genes . In some cases, reconstitution experiments adding purified cofactors or binding partners may be necessary to restore activity lost during heterologous expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.