Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1283 (MJ1283)

Basic Research Questions

• What is Methanocaldococcus jannaschii and why is it significant in research?

  Methanocaldococcus jannaschii is a hyperthermophilic methanogenic archaeon isolated from deep-sea hydrothermal vents. It grows at temperatures between 48-94°C with an optimum near 85°C and pressures up to more than 200 atm . Its significance stems from being the first archaeon to have its complete genome (1.66-megabase pair) sequenced in 1996 , providing foundational insights into archaeal biology and evolutionary relationships. M. jannaschii performs hydrogenotrophic methanogenesis (4H₂ + CO₂ → CH₄ + 2H₂O), an ancient respiratory metabolism dating back approximately 3.49 billion years . Living in conditions mimicking early Earth environments, it represents a minimal requirement for life to exist independent of other living systems and serves as a model organism for studying early Earth metabolism.

• What is known about the MJ1283 protein's structure and function?

  MJ1283 remains largely uncharacterized in terms of specific biological function. The protein consists of 220 amino acids with the sequence: "MVEMNKRGQFFIIGGVILSIGLILFFLLGFNSYTSDGSYLTVFKMKDVKNSIESCLINSL TSNSNLSKNLDMLKNNYKDEGIEINYKKIIFSNIRYEAKNLTFNFSLYNGNFSYNISNYG FGGAFNGSLNVSNYVFSKNLLLNISENGSVTGSFNITGSYVNVFVYDRFGNLILNETIYN NSNEKSLYYYILNVSKEGILLYLLWQRMFLTTHWQKMYPL" . Computational analysis of this sequence suggests the presence of hydrophobic stretches that might indicate transmembrane domains, potentially suggesting membrane association. The protein has been assigned the UniProt ID Q58679 , but its three-dimensional structure and precise molecular function remain to be experimentally determined.

• What expression systems are commonly used for recombinant production of MJ1283?

  The predominant expression system used for recombinant production of MJ1283 is Escherichia coli. As documented in available research, the full-length MJ1283 protein (1-220aa) is typically expressed with an N-terminal histidine tag (His-tag) in E. coli . This approach facilitates downstream purification through affinity chromatography techniques. When expressing archaeal proteins in bacterial systems, researchers must consider potential challenges including codon usage differences, protein folding requirements, and post-translational modifications that may differ between archaea and bacteria. For hyperthermophilic proteins, expression conditions often require optimization to ensure proper folding and solubility of the recombinant product.

• How is the purity of recombinant MJ1283 protein typically assessed?

  The purity of recombinant MJ1283 protein is primarily assessed using SDS-PAGE (Sodium Dodecyl Sulfate-Polyacrylamide Gel Electrophoresis), with commercial preparations typically achieving greater than 90% purity . Additional analytical methods may include:

  • Western blotting using anti-His antibodies to confirm the presence of the His-tagged protein

  • Mass spectrometry for precise molecular weight determination and confirmation of protein identity

  • Size exclusion chromatography to assess aggregation state and homogeneity

  • Dynamic light scattering to evaluate size distribution and potential oligomerization

  For functional studies, activity assays would be valuable, though these are challenging for uncharacterized proteins like MJ1283 where the biological function remains unknown.

Intermediate Research Questions

• What experimental designs are optimal for studying MJ1283 function?

  Optimal experimental designs for studying MJ1283 function should follow established principles of true experimental design as outlined by Campbell and Stanley , incorporating appropriate controls and statistical analyses. A comprehensive approach would include:

  Table 1: Experimental Design Approaches for MJ1283 Functional Characterization

  Approach	Methodology	Advantages	Limitations
  Genetic knockout	Gene deletion using homologous recombination in M. jannaschii	Direct assessment of phenotypic effects in native organism	Requires sophisticated genetic tools; lethal phenotypes cannot be studied
  Comparative genomics	Identification of homologs across archaea and analysis of conservation patterns	Can identify functional domains and evolutionary relationships	Correlative evidence only; requires experimental validation
  Localization studies	Expression of tagged MJ1283 to determine subcellular location	Provides insights into potential function based on location	Tag may interfere with native function
  Interactome analysis	Pull-down assays to identify binding partners	Identifies functional associations	May miss transient interactions; requires validation
  Structural studies	X-ray crystallography or cryo-EM	Reveals potential functional domains and binding sites	Technically challenging; structure doesn't always reveal function

  Recent development of genetic tools for M. jannaschii now enables more sophisticated in vivo studies than were previously possible, allowing for more robust experimental designs with appropriate controls.

• How can researchers properly store and reconstitute MJ1283 protein for maximum stability and activity?

  Proper storage and reconstitution of MJ1283 protein are critical for maintaining its structural integrity and potential biological activity. Based on established protocols for recombinant MJ1283 , researchers should:

  For storage:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freezing and thawing which can lead to protein denaturation

  For reconstitution:

  • Briefly centrifuge vials before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

  • The protein is typically supplied in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability

  For functional studies, researchers should consider that as a protein from a hyperthermophile, MJ1283 may exhibit optimal activity at elevated temperatures that mimic its native environment (around 85°C).

• What challenges are associated with studying proteins from hyperthermophilic archaea like M. jannaschii?

  Studying proteins from hyperthermophilic archaea presents several unique challenges that researchers must address:

  • Expression challenges: Heterologous expression in mesophilic hosts like E. coli may result in improper folding, aggregation, or inclusion body formation due to temperature differences

  • Structural considerations: Proteins from hyperthermophiles like M. jannaschii have specific adaptations for thermostability, including higher residue volume, increased hydrophobicity, more charged amino acids, and fewer uncharged polar residues compared to mesophilic proteins

  • Assay conditions: Standard biochemical assays may need modification to accommodate high-temperature requirements for optimal activity

  • Genetic manipulation: Although recent breakthroughs have enabled genetic manipulation of M. jannaschii , these techniques are still evolving and more challenging than for model organisms

  • Native environment simulation: Recreating the extreme conditions of deep-sea hydrothermal vents (high pressure, high temperature, specific gas composition) in laboratory settings is technically demanding

  • Protein purification: Proteins must be handled to preserve their native conformations while removing contaminants that could interfere with functional studies

• How can bioinformatic approaches help predict potential functions of MJ1283?

  Bioinformatic approaches offer valuable tools for predicting potential functions of uncharacterized proteins like MJ1283:

  Sequence-based analysis:

  • Multiple sequence alignment with homologous proteins across different species

  • Identification of conserved domains and motifs using databases like Pfam, PROSITE, or InterPro

  • Secondary structure prediction to identify functional elements (e.g., transmembrane domains, signal peptides)

  Structural analysis:

  • Ab initio or template-based 3D structure prediction using tools like AlphaFold

  • Structural comparison with proteins of known function

  • Active site prediction and ligand-binding pocket analysis

  Genomic context analysis:

  • Examination of genomic neighborhood for functionally related genes

  • Identification of potential operons or co-regulated genes

  Expression analysis:

  • Mining transcriptomic data to identify conditions under which MJ1283 is expressed

  • Co-expression analysis to identify functionally related genes

  These computational predictions should guide experimental approaches but require validation through biochemical and genetic studies.