Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1290 (MJ1290)

What is Methanocaldococcus jannaschii MJ1290 protein and why is it of research interest?

MJ1290 is an uncharacterized protein from the hyperthermophilic methanogenic archaeon Methanocaldococcus jannaschii. It consists of 312 amino acids and contains a predicted N-terminal signal sequence suggesting it may be membrane-associated or secreted . The protein is of particular research interest because it represents one of many functionally uncharacterized proteins from extremophilic archaea, providing opportunities to discover novel biochemical activities, structural features, and potential biotechnological applications.

The study of archaeal proteins like MJ1290 contributes to our understanding of protein evolution, adaptation to extreme environments, and archaeal cell biology. M. jannaschii was the first archaeal genome to be completely sequenced, making its proteome particularly valuable for comparative genomics and evolutionary studies .

What expression systems are recommended for producing recombinant MJ1290 protein?

The most common and effective expression system for MJ1290 is Escherichia coli, as evidenced by the commercial recombinant protein being expressed in this host . When expressing archaeal proteins in bacterial systems, researchers should consider the following methodological approaches:

• Codon optimization: Adjust the coding sequence to match codon usage bias in E. coli to improve expression levels.

• Temperature modulation: Lower induction temperatures (16-25°C) often improve folding of archaeal proteins in mesophilic hosts.

• Solubility tags: Fusion with solubility-enhancing tags such as His, MBP, GST, or SUMO can improve yield and facilitate purification.

• Specialized E. coli strains: Use of Rosetta, Arctic Express, or C41/C43 strains to address specific expression challenges.

For particularly challenging expressions, alternative systems such as archaeal hosts (e.g., Thermococcus kodakarensis or Sulfolobus solfataricus) may be considered, though these require specialized expertise and equipment for high-temperature cultivation.

What are the optimal storage and handling conditions for recombinant MJ1290 protein?

Based on documented protocols for similar archaeal proteins and the specific information provided for recombinant MJ1290, the following storage and handling recommendations apply:

• Storage buffer: Tris/PBS-based buffer with 6% trehalose at pH 8.0 maintains stability during storage .

• Long-term storage: Store at -20°C/-80°C with 30-50% glycerol as cryoprotectant to prevent freeze-thaw damage .

• Working aliquots: Store at 4°C for up to one week to avoid repeated freeze-thaw cycles .

• Reconstitution: Reconstitute lyophilized protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL before adding glycerol for storage .

• Preparation for experiments: Briefly centrifuge vials before opening to ensure all material is at the bottom .

These conditions are optimized to maintain protein integrity while preventing aggregation and proteolytic degradation, particularly important for proteins from hyperthermophilic sources which may have unusual stability characteristics.

What approaches should be used to determine the structure of MJ1290?

Determining the structure of an uncharacterized archaeal protein like MJ1290 requires a strategic approach combining multiple techniques. Based on successful structural studies of other M. jannaschii proteins, the following methodological workflow is recommended:

• Protein purification optimization:

  • Heat shock treatment (70-80°C) to exploit thermostability of archaeal proteins

  • Ion exchange chromatography (e.g., HiTrap Q column)

  • Affinity chromatography (e.g., HiTrap Blue column)

  • Size exclusion chromatography (e.g., Superdex75)

• Crystallization screening:

  • Initial screens using commercial kits (Crystal Screens 1 and 2, PEG/Ion Screen, SaltRX)

  • Optimization of promising conditions by varying precipitant concentration, pH, and additives

  • Consider inclusion of detergents for membrane-associated proteins (e.g., FOS-choline)

• X-ray diffraction data collection:

  • Synchrotron radiation sources provide high-intensity X-rays ideal for archaeal protein crystals

  • Cryoprotection using glycerol, ethylene glycol, or low-molecular-weight PEGs

  • Multiple wavelength anomalous dispersion (MAD) or molecular replacement for phase determination

• Alternative structural approaches:

  • Cryo-electron microscopy for proteins resistant to crystallization

  • Nuclear magnetic resonance (NMR) for smaller domains or fragments

  • Small-angle X-ray scattering (SAXS) for low-resolution envelope determination

The successful structural determination of MJ1225 at 2.3 Å resolution provides a valuable precedent and methodological framework that can be adapted for MJ1290 structural studies.

How can bioinformatic approaches help predict structural features of MJ1290?

For uncharacterized proteins like MJ1290, bioinformatic analysis can provide valuable structural insights prior to experimental determination. A comprehensive bioinformatic approach should include:

• Sequence-based predictions:

  • Secondary structure prediction using PSIPRED, JPred, or SOPMA

  • Disorder prediction using DISOPRED or IUPred

  • Transmembrane segment prediction using TMHMM or Phobius (particularly relevant given MJ1290's potential membrane association)

  • Signal peptide prediction using SignalP (the MJ1290 sequence suggests a signal peptide)

• Structure prediction:

  • AlphaFold2 or RoseTTAFold for state-of-the-art 3D structure prediction

  • I-TASSER or Phyre2 for fold recognition and threading

  • Comparison of multiple models to identify consistently predicted structural features

• Function prediction from structure:

  • Active site prediction using CASTp or POOL

  • Ligand binding site prediction using 3DLigandSite or COACH

  • Structural classification using CATH or SCOP databases

• Homology detection:

  • HHpred or FFAS for sensitive remote homology detection

  • Identification of structural homologs in thermophilic organisms

The amino acid sequence of MJ1290 (MKKAIYLLILCIFGLFSVYFTYAENISDISNTTSKNISSSNISHNNIIYSNINYNEILYIIVKNNTAYVKDVINGTNNPYHIKSAGIILYEKIYGYNYSNLLYRNSSNSLIFYYNFSVDKINYTINITIPQIEDYVGSLGGPIRMRIPPNNVKIIIVAENKLAETNGKYILEYNKTDKKV ISLIYLDNVSSICNIYYTKFFNSSEFYGYAVANVTSITENRTSYTIKNPKGTFTFDRKYNVFVSNKTAYLKEPYLYVKLYNSTIDDIIILENNKISENSTKFMSNYLLSFIGIIIGFGIIGLAIYLSKRGRK) can be analyzed using these tools to develop hypotheses about its structure and potential function.

What experimental approaches are recommended for determining the function of uncharacterized archaeal proteins like MJ1290?

Determining the function of completely uncharacterized archaeal proteins requires a multi-faceted approach combining genomic context, biochemical assays, and structural information. Based on successful characterization of other M. jannaschii proteins, the following methodological workflow is recommended:

• Genomic context analysis:

  • Examine neighboring genes for functional clues

  • Identify conserved operons across archaeal species

  • Analyze phylogenetic distribution patterns

• Expression profiling:

  • Determine under which conditions the protein is expressed

  • Analyze transcript levels in response to environmental stressors

  • Perform ribosome profiling to confirm translation

• Protein interaction studies:

  • Pull-down assays with tagged recombinant protein

  • Yeast two-hybrid or bacterial two-hybrid screening

  • Crosslinking mass spectrometry to identify interaction partners

• Biochemical activity screening:

  • Test for common enzymatic activities (hydrolase, transferase, etc.)

  • Substrate screening using metabolite arrays

  • Activity-based protein profiling with activity-based probes

• Genetic approaches:

  • Gene knockout or CRISPR interference in model archaeal organisms

  • Heterologous complementation in bacterial systems

  • Phenotypic analysis of mutants under various conditions

The successful functional reclassification of MJ0490 from a putative lactate dehydrogenase to a malate dehydrogenase demonstrates how experimental characterization can clarify the function of initially misannotated or uncharacterized archaeal proteins.

How can the membrane-associated properties of MJ1290 be experimentally verified?

The amino acid sequence of MJ1290 suggests it may be membrane-associated due to its predicted signal peptide and transmembrane regions . To experimentally verify these properties, researchers should consider the following systematic approach:

• Membrane fractionation:

  • Differential centrifugation to separate membrane fractions

  • Sucrose gradient ultracentrifugation for membrane subfractionation

  • Western blot analysis to detect MJ1290 in specific fractions

• Membrane protein solubilization:

  • Detergent screening (nonionic, zwitterionic, and ionic detergents)

  • Systematic testing of detergent:protein ratios

  • Native extraction using styrene-maleic acid copolymer (SMA) or amphipols

• Topological analysis:

  • Protease protection assays to determine orientation

  • Site-directed labeling of cysteine residues with membrane-impermeable reagents

  • Fluorescence microscopy with GFP-fusion constructs in model cells

• Lipid interaction studies:

  • Liposome binding assays with purified recombinant protein

  • Förster resonance energy transfer (FRET) between labeled protein and membrane dyes

  • Differential scanning calorimetry to measure lipid phase transitions

• Structural studies in membrane-mimetic environments:

  • Crystallization in the presence of detergents (as demonstrated for MJ1225)

  • Cryo-EM analysis in nanodiscs or lipid bilayers

  • Solid-state NMR with reconstituted proteoliposomes

These methodologies should be performed under conditions that respect the thermophilic nature of M. jannaschii proteins, potentially using thermostable detergents and lipids from archaeal sources when available.

What strategies can be employed to overcome expression and purification challenges specific to MJ1290?

Expression and purification of archaeal membrane-associated proteins like MJ1290 present unique challenges that require specialized approaches. Based on successful strategies with similar proteins, the following troubleshooting workflow is recommended:

• Expression optimization matrix:

• Solubilization strategies:

  • Inclusion of molecular chaperones (GroEL/ES, DnaK/J)

  • Co-expression with archaeal chaperones

  • Addition of osmolytes (glycine betaine, proline) to culture media

  • Periplasmic expression for proteins with disulfide bonds

• Purification under denaturing conditions:

  • Solubilization in 8M urea or 6M guanidinium hydrochloride

  • On-column refolding with decreasing denaturant gradient

  • Step-wise dialysis for controlled refolding

• Hyperthermophile-specific approaches:

  • Heat treatment (70-80°C) to eliminate host proteins

  • Inclusion of stabilizing ions (K+, Mg2+) in buffers

  • Purification at elevated temperatures (50-60°C)

  • Use of thermostable affinity resins

The successful purification of MJ1225 using heat shock treatment at 348K (75°C) demonstrates the effectiveness of exploiting thermostability for purification of M. jannaschii proteins.

How can researchers investigate the potential role of MJ1290 in archaeal cellular processes?

Investigating the biological role of MJ1290 in archaeal cellular processes requires integrating molecular, cellular, and systems biology approaches. The following comprehensive research strategy is recommended:

• Localization studies:

  • Immunogold electron microscopy with anti-MJ1290 antibodies

  • Super-resolution microscopy with fluorescently tagged protein

  • Cell fractionation followed by proteomic analysis

  • Correlation of localization with cellular structures and membrane domains

• Temporal expression analysis:

  • Time-course transcriptomics during growth phases

  • Protein abundance changes in response to environmental stressors

  • Correlation with metabolic shifts (e.g., during nutrient limitation)

  • Post-translational modification dynamics by phosphoproteomics or glycoproteomics

• Interaction network mapping:

  • Affinity purification-mass spectrometry (AP-MS)

  • Proximity-dependent biotin identification (BioID)

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

  • Computational prediction of functional partners

• Genetic manipulation approaches:

  • Construction of conditional knockdown strains

  • CRISPR interference for targeted repression

  • Overexpression phenotype analysis

  • Genetic suppressor screening

• Evolutionary analysis:

  • Identification of orthologs across archaeal lineages

  • Correlation of presence/absence with ecological niches

  • Detection of selection signatures indicating functional importance

  • Ancestral sequence reconstruction to track evolutionary trajectory

These approaches should be integrated with computational modeling of archaeal cellular processes to generate testable hypotheses about MJ1290's role in M. jannaschii biology.

What analytical techniques are most appropriate for studying protein-protein interactions involving MJ1290 under extreme conditions?

Studying protein-protein interactions under the extreme conditions relevant to M. jannaschii (optimal growth at 85°C and high pressure) presents unique challenges requiring specialized approaches. The following analytical techniques are recommended:

• Thermostable crosslinking approaches:

  • Formaldehyde or glutaraldehyde crosslinking at elevated temperatures

  • Photo-activatable crosslinkers with improved thermal stability

  • Crosslinking mass spectrometry (XL-MS) optimized for thermophilic samples

  • In vivo crosslinking in thermophilic model organisms

• Biophysical methods adapted for high temperatures:

  • Differential scanning calorimetry (DSC) with extended temperature range

  • Isothermal titration calorimetry (ITC) in high-temperature cells

  • Surface plasmon resonance (SPR) with thermostable sensor chips

  • Analytical ultracentrifugation with temperature-controlled rotors

• Specialized co-purification approaches:

  • Tandem affinity purification with thermostable tags

  • Co-immunoprecipitation using thermostable antibodies or nanobodies

  • Native gel electrophoresis under thermal control

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

• Advanced microscopy techniques:

  • Förster resonance energy transfer (FRET) with thermostable fluorophores

  • Single-molecule fluorescence microscopy with temperature control

  • High-speed atomic force microscopy under variable temperature conditions

  • Cryo-electron microscopy to capture interaction states

• Computational prediction and validation:

  • Molecular dynamics simulations at elevated temperatures

  • Protein docking with conformational sampling at high temperatures

  • Network analysis incorporating thermodynamic parameters

  • Machine learning approaches trained on thermophilic interaction datasets

These methodologies should be customized to account for the specific biochemical properties of MJ1290, including its potential membrane association and the extreme conditions under which native interactions would occur.

How should experiments be designed to investigate the potential enzymatic activity of MJ1290?

Investigating potential enzymatic activities of an uncharacterized protein like MJ1290 requires a systematic approach that combines bioinformatic prediction with biochemical screening. The following experimental design is recommended:

• Initial activity prediction:

  • Identify conserved domains or motifs using InterPro, PFAM, or CDD

  • Search for catalytic triads or metal-binding sites in the sequence

  • Analyze structural predictions for pocket formation and substrate accessibility

  • Compare with characterized proteins sharing structural similarity

• High-throughput screening strategies:

  • Activity-based protein profiling with diverse activity-based probes

  • Metabolite array screening for binding and modification

  • Colorimetric or fluorescent assays in microtiter format

  • Mass spectrometry-based screening for product formation

• Targeted assay design:

  • Based on genomic context (neighboring genes may suggest pathway involvement)

  • Considering the extreme environment of M. jannaschii (high temperature, pressure)

  • Testing activities essential for archaeal membrane processes

  • Examining potential roles in archaeal-specific metabolic pathways

• Enzymatic characterization workflow:

• Site-directed mutagenesis:

  • Mutation of predicted catalytic residues

  • Construction of chimeric proteins with related enzymes

  • Deletion or modification of specific domains

  • Introduction of residues from mesophilic homologs to test thermostability determinants

The successful reclassification of MJ0490 from a putative lactate dehydrogenase to a malate dehydrogenase through structural and enzymatic characterization provides a valuable precedent for uncovering the true function of uncharacterized M. jannaschii proteins.

What controls and validation steps are essential when working with recombinant archaeal proteins like MJ1290?

• Protein quality controls:

  • Mass spectrometry verification of protein identity

  • Size exclusion chromatography to confirm oligomeric state

  • Circular dichroism to verify proper folding

  • Dynamic light scattering to assess homogeneity

  • Thermal shift assays to evaluate stability

• Expression system controls:

  • Empty vector controls processed identically to recombinant protein

  • Host cell background activity measurements

  • Comparison of different expression systems

  • Validation of tag effects on protein function

• Activity assay controls:

  • Substrate-only and enzyme-only controls

  • Heat-denatured enzyme negative controls

  • Known enzymes as positive controls

  • Buffer composition matched between samples

• Environmental parameter validation:

  • Confirmation of temperature stability throughout experiments

  • pH monitoring during high-temperature incubations

  • Oxygen exclusion for anaerobic enzyme studies

  • Pressure effects for deep-sea archaeal proteins

• Replication and statistical validation:

  • Biological replicates (independent protein preparations)

  • Technical replicates (multiple measurements)

  • Appropriate statistical tests for significance

  • Power analysis to determine sample size requirements

These controls are particularly important for archaeal proteins like MJ1290, which may exhibit unusual properties related to their adaptation to extreme environments and may not behave as expected based on mesophilic protein paradigms.