Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1293 (MJ1293)

Shipped with Ice Packs
In Stock

Description

Protein Overview

MJ1293 is encoded by the MJ1293 gene located on the large circular chromosome of M. jannaschii. The protein is classified as "uncharacterized" due to the absence of homology to well-studied proteins or established functional domains . Key attributes include:

  • Gene Name: MJ1293 (ordered locus name) .

  • UniProt ID: Q58689 .

  • Sequence: 231 amino acids (predicted molecular weight: ~26 kDa) .

Genomic and Evolutionary Context

  • Genomic Location: Part of the 1.66-Mbp chromosome of M. jannaschii, which contains 1,682 predicted protein-coding genes .

  • Conservation: Limited homology to proteins outside Methanocaldococcus species, suggesting archaea-specific functions .

  • Annotation Challenges: MJ1293 is among ~30% of M. jannaschii genes lacking functional assignments despite advanced genomic tools .

Research Applications

  • Structural Studies: Used in crystallography trials to resolve 3D architecture (no published structures yet) .

  • Metabolic Pathway Analysis: Included in pathway databases (e.g., MjCyc) for hypothetical assignments in methanogenesis cofactor synthesis .

  • Biotechnological Potential: Investigated for industrial enzyme engineering due to thermostability .

Unresolved Questions

  • Function: No enzymatic activity or cellular role confirmed .

  • Regulation: Unknown transcriptional or post-translational controls.

  • Phylogenetic Distribution: Absent in non-methanogenic archaea, complicating comparative genomics .

References and Data Sources

  1. Commercial Specifications: Creative BioMart .

  2. Genomic Context: M. jannaschii DSM 2661 genome annotation .

  3. Evolutionary Insights: Comparative analysis in MjCyc .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes if needed. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request, but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
MJ1293; Uncharacterized protein MJ1293
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1293
Target Protein Sequence
MTNKTRKETNEIKNNITLPPNIKTEVNRTSKYDFTNLSKDLEIVYALIKITGFDEYLPFN IENLNKIFIKEKISPYPYLLNLIKDLIILFVIGLIITIIGLLMYEPTRPKVISIIASILY KLKIKEKPKPKKKETIKLPKPPKIYISDVIYSLGDTVRIEISSEIDIGNNLYILSPTNKK YKIELIKTGKNKYLGLFKIPENEVPGQYFIIYKPENLSIGGFLVVDIKKEM
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1293

STRING: 243232.MJ_1293

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why are its uncharacterized proteins significant for research?

Methanocaldococcus jannaschii is a phylogenetically deeply rooted hyperthermophilic methanarchaeon that grows optimally at temperatures around 85°C . It represents one of the evolutionary ancient methanogens and was one of the first archaeal genomes to be sequenced. Uncharacterized proteins from this organism are particularly significant because:

  • They provide insights into archaeal-specific biochemical pathways

  • Their hyperthermostable nature makes them valuable for both fundamental research and biotechnological applications

  • They can help elucidate evolutionary relationships between the three domains of life

  • Studying these proteins contributes to our understanding of adaptation to extreme environments

The organism's rapid growth rate (doubling time of approximately 26 minutes) compared to other methanogens makes it particularly attractive for experimental studies .

What expression systems are available for recombinant M. jannaschii proteins?

Two main approaches can be employed for expressing recombinant M. jannaschii proteins:

Expression SystemAdvantagesDisadvantagesTypical Yield
Heterologous (E. coli)Easier cultivation, established protocolsMay lack proper folding at high temperatures, possible codon bias issuesVariable
Homologous (M. jannaschii)Native conditions for proper folding, authentic post-translational modificationsMore technically challenging, requires specialized equipment~0.26 mg/L culture

For homologous expression, recent developments include a genetic system utilizing linearized suicide vectors and affinity tagging approaches (e.g., 3xFLAG-Twin Strep tag), enabling successful purification of M. jannaschii proteins from their native host .

How can researchers cultivate M. jannaschii for protein expression studies?

M. jannaschii requires specific cultivation conditions:

  • Temperature: Optimal growth at approximately 85°C

  • Atmosphere: Strictly anaerobic conditions

  • Solid medium: Gelrite® gellan gum as a gelling agent, suitable for hyperthermophiles

  • Reducing agents: Additional reducing agents beyond standard sulfide (2 mM) are required, such as cysteine (2 mM) or titanium (III) citrate (0.14 mM)

  • Colony formation: Visible colonies appear after 2-3 days of incubation, which is faster than other methanogens

  • Medium supplements: Addition of yeast extract yields larger colonies that are easier to pick

These specialized growth conditions are essential for maintaining viable cultures for protein expression experiments.

What purification strategies work best for uncharacterized M. jannaschii proteins?

For purification of uncharacterized proteins from M. jannaschii:

  • Affinity chromatography: The 3xFLAG-Twin Strep tag system has been successfully employed, allowing purification using a Streptactin XT superflow column with elution using 10 mM D-biotin

  • Quality assessment: SDS-PAGE analysis for homogeneity verification, Western blotting for tag confirmation

  • Identity confirmation: Mass spectrometric analysis of enzyme digests (e.g., thermolysin) can identify peptides covering >50% of the protein sequence including tags

  • Activity preservation: Purification protocols must maintain the thermostability and activity of the target protein

Homologous expression with affinity tags has been demonstrated to provide pure, active enzyme as shown with the FprA protein from M. jannaschii .

What genetic tools are available for manipulating M. jannaschii to study uncharacterized proteins in vivo?

Recent advances have established a comprehensive genetic system for M. jannaschii:

  • Transformation protocols: Heat shock transformation rather than chemical treatments used for other methanogens

  • Selection markers: Mevinolin resistance for identifying transformants

  • Vectors: Linearized suicide vectors for homologous recombination, avoiding merodiploid formation through single crossover events

  • Promoter engineering: Modified versions of native promoters (e.g., P*) for controlled expression

  • Protein tagging: Successful integration of affinity tags (3xFLAG-Twin Strep) for protein purification and detection

  • Colony formation: Efficient plating techniques yielding colonies in 3-4 days compared to 7-14 days for other methanogens

These tools enable in vivo study of protein function and can be applied to investigate uncharacterized proteins like MJ1293.

How can metabolic reconstruction approaches predict functions for uncharacterized M. jannaschii proteins?

Computational metabolic reconstruction provides powerful insights into potential functions of uncharacterized proteins:

  • The PathoLogic software has identified 609 metabolic reactions assembled into 113 metabolic pathways and 17 super-pathways in M. jannaschii

  • This approach can identify "missing" enzymatic activities within pathways, suggesting potential roles for uncharacterized proteins

  • Previously unknown enzymes involved in sulfate assimilation, methionine synthesis, cobalamin biosynthesis, and the mevalonate pathway have been identified through these methods

  • Pathway Tools assists in eliminating problems like false positives from weak sequence similarities, paralogous families, or unclear function assignments in database entries

For proteins like MJ1293, integration into the metabolic network can provide testable hypotheses about biochemical function.

What experimental approaches are most effective for resolving contradictions between computational predictions and experimental data?

When faced with conflicts between bioinformatic predictions and experimental results for proteins like MJ1293:

  • Re-evaluate computational predictions: Check for false positives from weak sequence similarities or paralogous families

  • Optimize experimental conditions: Ensure that assay conditions (temperature, pH, cofactors) reflect the native environment of M. jannaschii

  • Apply multiple methodologies: Combine structural analysis, biochemical assays, and genetic approaches

  • Consider physiological context: Test protein function under varying metabolic conditions that might reveal context-dependent activities

  • Explore protein-protein interactions: Identify potential interaction partners that might be required for function

  • Employ homologous expression: Test function in the native organism to account for specific cellular factors

An integrated approach combining these strategies provides the most robust resolution to contradictory data.

How should researchers design experiments to characterize thermostable enzymes from M. jannaschii?

Experimental design for characterizing thermostable enzymes requires specific considerations:

Experimental FactorOptimization ApproachExample from Literature
TemperatureConduct assays at 70-85°C to reflect native conditionsFprA assayed at 70°C showed 19-38× higher activity than mesophilic homologs
Buffer selectionUse thermostable buffers that maintain pH at high temperatures-
Enzyme stabilityDetermine half-life at assay temperature prior to kinetic studies-
Cofactor requirementsIdentify and provide native cofactorsFprA required F₄₂₀H₂ as electron donor
Oxygen sensitivityPerform assays under anaerobic conditions when appropriate-
Control experimentsInclude heat-inactivated controls and mesophilic enzyme comparisons-

These considerations ensure that experimental conditions accurately reflect the native environment and provide meaningful results for thermostable enzymes.

How can structural biology approaches be applied to uncharacterized hyperthermophilic proteins?

Structural characterization of hyperthermophilic proteins from M. jannaschii presents unique challenges and opportunities:

  • Sample preparation: Homologous expression and affinity purification provide properly folded protein samples

  • Thermostability analysis: Differential scanning calorimetry to determine melting temperatures and stability profiles

  • Crystallization: Screen conditions at elevated temperatures, potentially including stabilizing agents

  • Cryo-EM: Potentially advantageous for proteins that resist crystallization

  • Molecular modeling: Comparative modeling based on structurally characterized homologs

  • Mass spectrometry: For analyzing post-translational modifications and protein complexes

Structural insights can provide crucial information about protein function, particularly for uncharacterized proteins where sequence-based predictions are ambiguous.

What are the potential biotechnological applications of uncharacterized M. jannaschii proteins?

Hyperthermophilic proteins from M. jannaschii have several potential applications:

  • Biocatalysis: Thermostable enzymes for industrial processes requiring high-temperature reactions

  • Methane production: Potential exploitation for commercial methane production in high-temperature bioreactors

  • Climate science: Models for studying greenhouse gas emission in high-temperature environments

  • Protein engineering: Thermostability principles that can be applied to engineer mesophilic proteins

  • Structural biology: Novel protein folds and stability mechanisms

For example, the FprA protein from M. jannaschii demonstrated oxygen reduction activity approximately 19-38 times higher than homologs from mesophilic methanogens, illustrating the enhanced catalytic capabilities possible with these hyperthermophilic enzymes .

What are the optimal conditions for genetic manipulation of M. jannaschii?

Based on recent advances in genetic systems for M. jannaschii:

  • Transformation protocol: Heat shock treatment is required, unlike chemical approaches used for other methanogens

  • Vector preparation: Linearized suicide vectors are preferred to avoid merodiploid formation

  • Selection conditions: Mevinolin resistance serves as an effective selectable marker

  • Recovery and growth: Incubation at 85°C under strictly anaerobic conditions

  • Colony screening: Visible colonies appear after 2-3 days, significantly faster than other methanogens (7-14 days)

These optimized conditions have been validated through successful genetic modifications, including promoter engineering and protein tagging .

How can integrated 'omics approaches advance understanding of uncharacterized proteins?

An integrated systems biology approach can provide comprehensive insights:

  • Genomics: Identifying genomic context and conserved regions across related species

  • Transcriptomics: Analyzing expression patterns under various conditions to identify co-regulated genes

  • Proteomics: Determining protein-protein interactions and post-translational modifications

  • Metabolomics: Identifying metabolic changes associated with protein function or deletion

  • Computational integration: Tools like PathoLogic that synthesize data into metabolic models

This multi-layered approach has successfully identified previously missing enzymatic activities in M. jannaschii, including phosphoadenosine phosphosulfate reductase (EC 1.8.4.8; MJ0406) and enzymes for methionine synthesis from homocysteine (EC 2.1.1.14; MJ1473) .

What are the most promising avenues for future research on uncharacterized M. jannaschii proteins?

Several key research directions warrant investigation:

  • Comprehensive functional genomics: Systematic characterization of all uncharacterized proteins

  • Adaptation mechanisms: Understanding how these proteins contribute to hyperthermophilic adaptation

  • Ancient protein functions: Investigating evolutionary conserved functions in this deeply rooted organism

  • Metabolic engineering: Developing M. jannaschii as a platform for high-temperature biocatalysis

  • Synthetic biology applications: Utilizing thermostable components in designed biological systems

The recent development of genetic tools for M. jannaschii opens unprecedented opportunities for these research directions .

How might advances in computational biology improve predictions for uncharacterized archaeal proteins?

Emerging computational approaches show particular promise:

  • Deep learning algorithms: Improved prediction of protein function from sequence and structure

  • Molecular dynamics simulations: Better modeling of protein behavior at extreme temperatures

  • Metabolic modeling: Enhanced integration of 'omics data into comprehensive metabolic models

  • Evolutionary analyses: More sophisticated methods for tracing protein evolution across domains of life

  • Network biology: Advanced techniques for placing proteins within their functional context

These computational advances, combined with the experimentally validated metabolic reconstruction approaches already applied to M. jannaschii , will likely accelerate functional annotation of uncharacterized proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.