The recombinant MJ1308 protein is commercially available as a lyophilized powder. Key production and storage parameters include:
MJ1308 is part of the M. jannaschii genome, which was the first archaeal genome sequenced . This archaeon is notable for its thermophilic lifestyle, methane production, and novel metabolic pathways .
ORF Classification: MJ1308 is listed among ORFs without significant homology to known sequences (Table 3 in patent WO1998007830A2) .
Functional Uncertainty: No biochemical function has been assigned to MJ1308, though its conserved sequence suggests potential roles in archaeal-specific processes .
Genetic Engineering: As a recombinant protein, MJ1308 could serve as a model for studying archaeal protein folding or thermostability .
Diagnostic Tools: The patent WO1998007830A2 proposes using M. jannaschii ORFs, including MJ1308, for diagnostic probes targeting archaeal species .
Structural Biology: The His-tagged version facilitates crystallization or NMR studies to elucidate its 3D structure .
| Position Range | Sequence |
|---|---|
| 1–108 | MVDFMDYNDFQKKLDKEEHGDGITVGAVYTGEFTLYLLFIFGALIIGRVYGKTLMTLFGL AALAFSLSVSPLIFKFKEENSNAINYQLFWLSIFLGAIAFCIYMTTRW |
KEGG: mja:MJ_1308
STRING: 243232.MJ_1308
MJ1308 represents one of the uncharacterized proteins from M. jannaschii's genome sequencing. While specific information about MJ1308 is limited, we can place it in context of M. jannaschii's genomic features. M. jannaschii possesses a large circular chromosome (1.66 megabase pairs) with 31.4% G+C content, as well as large and small circular extra-chromosomes . When working with uncharacterized proteins, examining whether the gene exists as part of an operon (like mj_0732) or as a monocistronic transcript (like mj_0748) provides important functional clues . Transcriptional analysis using RNA-seq can confirm the expression pattern of MJ1308 under various conditions, helping establish its genomic context.
Comparative analysis techniques reveal evolutionary relationships that inform function. Domain analysis using tools like NCBI's CD-search, Pfam, D-I-TASSER, and INTERPRO should be performed to identify conserved domains in MJ1308 . Researchers often discover hidden relationships through sequence alignment with proteins of known function. For example, proteins containing Mth938-like domains (as seen in other uncharacterized archaeal proteins) may indicate roles in specific cellular processes . A comprehensive phylogenetic analysis comparing MJ1308 to homologs in other Archaea provides evolutionary context and functional hints.
Understanding the basic properties of MJ1308 guides experimental design. Computational analysis should examine:
| Property | Prediction Tools | Significance |
|---|---|---|
| Molecular weight | ProtParam, ExPASy | Informs purification strategy |
| pI | ProtParam, ExPASy | Critical for protein isolation |
| Hydrophobicity | GRAVY calculator | Indicates membrane association |
| Secondary structure | PsiPred, JPred | Guides structural studies |
| Subcellular localization | PSORT, TargetP | Suggests functional environment |
| Thermal stability | ThermoMut, FoldX | Important for hyperthermophile proteins |
These properties inform experimental conditions for expression, purification, and functional assays. For hyperthermophilic archaeal proteins like those from M. jannaschii, temperature stability is particularly important when designing experimental workflows .
Recent advancements now allow genetic manipulation of M. jannaschii. A methodological approach includes:
Construction of a suicide plasmid containing:
Linearize the plasmid and transform M. jannaschii using the established protocol with selectable markers (e.g., mevinolin resistance)
Confirm successful transformation via PCR-based analysis of chromosomal DNA
Validate expression using Western blot with antibodies against the affinity tag
This approach, successfully demonstrated with other M. jannaschii proteins like Mj-FprA, offers a powerful way to express recombinant MJ1308 in its native host, preserving hyperthermophilic adaptations .
When native expression is challenging, heterologous systems offer alternatives:
| Expression System | Advantages | Limitations | Optimization Strategies |
|---|---|---|---|
| E. coli | High yield, ease of use | Protein misfolding, lack of archaeal post-translational modifications | Codon optimization, co-expression with chaperones, lower temperature induction |
| Yeast (S. cerevisiae, P. pastoris) | Eukaryotic processing, higher folding fidelity | Lower yields than E. coli | Optimize growth media, induction timing |
| Cell-free systems | Avoids toxicity issues, rapid | Expensive, limited scale | Supplement with archaeal ribosomes/factors |
| Archaeal hosts (H. volcanii, T. kodakarensis) | Similar cellular machinery | Lower yields, technical complexity | Optimize promoters, culture conditions |
For hyperthermophilic proteins like MJ1308, consider chaperone co-expression and thermostability-enhancing buffers. E. coli-based expression remains most common, but archaeal-specific features may necessitate specialized approaches .
A methodological purification approach includes:
Design constructs with appropriate affinity tags (His-tag, Strep-tag, or FLAG-tag) as demonstrated with other M. jannaschii proteins
Implement heat treatment (70-80°C) as initial purification step, exploiting thermostability of M. jannaschii proteins
Perform affinity chromatography under conditions that maintain protein stability
Consider size exclusion chromatography for higher purity
Verify protein identity using mass spectrometry and Western blot
Assess protein quality through circular dichroism and thermal shift assays
For hyperthermophilic proteins, include stabilizing agents (osmolytes, specific ions) in buffers throughout purification to maintain native conformation .
A comprehensive structural analysis workflow includes:
Computational structure prediction:
Experimental structure determination:
X-ray crystallography (optimization of crystallization conditions for thermophilic proteins)
Cryo-EM for larger complexes
NMR for dynamic regions
Functional structure analysis:
Ligand binding prediction through virtual screening
Conservation analysis to identify functional residues
Protein-protein interaction prediction
Structure determination enables hypothesis generation about MJ1308 function based on structural homology to characterized proteins .
Function determination requires multiple complementary approaches:
Computational function prediction:
Knockout/knockdown studies:
Protein interaction studies:
Pull-down assays using affinity-tagged MJ1308
Crosslinking mass spectrometry
Yeast two-hybrid with archaeal library
Biochemical assays:
Substrate screening
Activity assays based on predicted function
Metabolomic profiling of knockout strains
This multifaceted approach proved successful for other M. jannaschii proteins like the FprA homologs (Mj_0732 and Mj_0748) .
Investigating environmental adaptation requires systematic approaches:
Expression profiling:
Stress response analysis:
Comparative genomics:
Analysis of MJ1308 conservation across extremophiles
Identification of co-evolving genes suggesting functional relationships
Structural adaptation assessment:
Molecular dynamics simulations at different temperatures
Analysis of thermostabilizing features in protein structure
These approaches can reveal whether MJ1308 contributes to M. jannaschii's remarkable ability to thrive in extreme deep-sea hydrothermal vent environments .
As M. jannaschii derives energy solely from hydrogenotrophic methanogenesis, investigating MJ1308's role requires:
Metabolic context analysis:
Proximity to known methanogenesis genes
Differential expression during growth on CO2/H2
Enzymatic activity screening:
Testing for hydrogenase activity
Assessing interaction with methanogenic cofactors
Redox potential measurements
Metabolic flux analysis:
Isotope labeling studies in wildtype vs. MJ1308 mutants
Quantification of methanogenesis rates
Protein localization:
Membrane vs. cytoplasmic distribution
Association with known methanogenesis complexes
If MJ1308 contains domains similar to other redox proteins like FprA, it may participate in electron transfer pathways critical to M. jannaschii's ancient respiratory metabolism .
Stability challenges with thermophilic proteins expressed at mesophilic temperatures require:
Expression optimization:
Reducing expression temperature (15-18°C)
Adding stabilizing agents to media (osmolytes, specific ions)
Controlling induction rate with lower inducer concentrations
Purification considerations:
Rapid processing to minimize degradation
Including protease inhibitors optimized for thermophilic proteases
Maintaining higher temperatures during purification when possible
Storage stability:
Testing various buffer compositions
Evaluating cryoprotectants
Lyophilization optimization
Refolding strategies:
Heat activation steps (controlled heating to 60-80°C)
Chemical chaperoning with archaeal-specific cofactors
These strategies have proven effective for other M. jannaschii proteins that encounter stability challenges when manipulated at non-native temperatures .
Data inconsistencies require systematic troubleshooting:
Experimental validation:
Verify protein identity through mass spectrometry
Confirm structural integrity using circular dichroism
Ensure proper folding through activity controls
Condition-dependent effects:
Test function under varying temperatures, pH, and salt concentrations
Consider redox state and buffer components
Evaluate cofactor requirements
Statistical analysis:
Apply appropriate statistical tests to experimental data
Consider biological vs. technical replicates
Perform power analysis to determine adequate sample size
Integrative analysis:
Cross-validate results using multiple techniques
Evaluate consistency with evolutionary expectations
Compare with data from better-characterized homologs
When working with uncharacterized proteins like MJ1308, apparently contradictory results often reflect condition-dependent functions or multiple biochemical activities, as observed with multifunctional proteins like the F420-dependent sulfite reductase in M. jannaschii .
To determine domain functionality in MJ1308:
Domain-focused mutational analysis:
Site-directed mutagenesis of conserved residues
Truncation constructs to isolate potential domains
Chimeric proteins swapping domains with characterized proteins
Comparative biochemistry:
Side-by-side activity assays with known Mth938-domain proteins
Substrate competition experiments
Inhibitor sensitivity profiles
Structural confirmation:
Domain-specific labeling for structural studies
Hydrogen-deuterium exchange mass spectrometry
Conformational antibodies recognizing specific domain states
Biophysical characterization:
Thermal shift assays with potential ligands
Isothermal titration calorimetry for binding constants
Surface plasmon resonance for interaction kinetics