Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1308 (MJ1308)

Shipped with Ice Packs
In Stock

Description

Key Features:

PropertyDetails
Host OrganismEscherichia coli (used for recombinant expression)
TagN-terminal His-tag (for purification)
Purity>90% (determined by SDS-PAGE)
Genomic LocationLarge circular chromosome of M. jannaschii (1.66 Mbp)
Gene NameMJ1308 (synonyms: Uncharacterized protein MJ1308)

Production and Handling

The recombinant MJ1308 protein is commercially available as a lyophilized powder. Key production and storage parameters include:

Research Context and Potential Applications

MJ1308 is part of the M. jannaschii genome, which was the first archaeal genome sequenced . This archaeon is notable for its thermophilic lifestyle, methane production, and novel metabolic pathways .

Genomic Insights

  • ORF Classification: MJ1308 is listed among ORFs without significant homology to known sequences (Table 3 in patent WO1998007830A2) .

  • Functional Uncertainty: No biochemical function has been assigned to MJ1308, though its conserved sequence suggests potential roles in archaeal-specific processes .

Potential Applications

  1. Genetic Engineering: As a recombinant protein, MJ1308 could serve as a model for studying archaeal protein folding or thermostability .

  2. Diagnostic Tools: The patent WO1998007830A2 proposes using M. jannaschii ORFs, including MJ1308, for diagnostic probes targeting archaeal species .

  3. Structural Biology: The His-tagged version facilitates crystallization or NMR studies to elucidate its 3D structure .

Amino Acid Sequence

Position RangeSequence
1–108MVDFMDYNDFQKKLDKEEHGDGITVGAVYTGEFTLYLLFIFGALIIGRVYGKTLMTLFGL AALAFSLSVSPLIFKFKEENSNAINYQLFWLSIFLGAIAFCIYMTTRW

Key References

SourceRelevance
Commercial production details, purification tags, and storage conditions.
Genomic context, ORF classification, and potential diagnostic applications.
M. jannaschii biology, genome sequencing, and unique metabolic pathways.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during the production process. If you have a preferred tag type, please inform us and we will prioritize its development.
Synonyms
MJ1308; Uncharacterized protein MJ1308
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1308
Target Protein Sequence
MVDFMDYNDFQKKLDKEEHGDGITVGAVYTGEFTLYLLFIFGALIIGRVYGKTLMTLFGL AALAFSLSVSPLIFKFKEENSNAINYQLFWLSIFLGAIAFCIYMTTRW
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1308

STRING: 243232.MJ_1308

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the genomic context of MJ1308 in M. jannaschii?

MJ1308 represents one of the uncharacterized proteins from M. jannaschii's genome sequencing. While specific information about MJ1308 is limited, we can place it in context of M. jannaschii's genomic features. M. jannaschii possesses a large circular chromosome (1.66 megabase pairs) with 31.4% G+C content, as well as large and small circular extra-chromosomes . When working with uncharacterized proteins, examining whether the gene exists as part of an operon (like mj_0732) or as a monocistronic transcript (like mj_0748) provides important functional clues . Transcriptional analysis using RNA-seq can confirm the expression pattern of MJ1308 under various conditions, helping establish its genomic context.

How does MJ1308 compare to other uncharacterized proteins in Archaea?

Comparative analysis techniques reveal evolutionary relationships that inform function. Domain analysis using tools like NCBI's CD-search, Pfam, D-I-TASSER, and INTERPRO should be performed to identify conserved domains in MJ1308 . Researchers often discover hidden relationships through sequence alignment with proteins of known function. For example, proteins containing Mth938-like domains (as seen in other uncharacterized archaeal proteins) may indicate roles in specific cellular processes . A comprehensive phylogenetic analysis comparing MJ1308 to homologs in other Archaea provides evolutionary context and functional hints.

What are the predicted physicochemical properties of MJ1308?

Understanding the basic properties of MJ1308 guides experimental design. Computational analysis should examine:

PropertyPrediction ToolsSignificance
Molecular weightProtParam, ExPASyInforms purification strategy
pIProtParam, ExPASyCritical for protein isolation
HydrophobicityGRAVY calculatorIndicates membrane association
Secondary structurePsiPred, JPredGuides structural studies
Subcellular localizationPSORT, TargetPSuggests functional environment
Thermal stabilityThermoMut, FoldXImportant for hyperthermophile proteins

These properties inform experimental conditions for expression, purification, and functional assays. For hyperthermophilic archaeal proteins like those from M. jannaschii, temperature stability is particularly important when designing experimental workflows .

How can I design a genetic system to express recombinant MJ1308 in M. jannaschii?

Recent advancements now allow genetic manipulation of M. jannaschii. A methodological approach includes:

  • Construction of a suicide plasmid containing:

    • Upstream and 5'-end coding regions of MJ1308 for homologous recombination

    • Affinity tag sequence (e.g., 3xFLAG-twin Strep tag) for protein purification

    • An engineered promoter (such as P*) for controlled expression

  • Linearize the plasmid and transform M. jannaschii using the established protocol with selectable markers (e.g., mevinolin resistance)

  • Confirm successful transformation via PCR-based analysis of chromosomal DNA

  • Validate expression using Western blot with antibodies against the affinity tag

This approach, successfully demonstrated with other M. jannaschii proteins like Mj-FprA, offers a powerful way to express recombinant MJ1308 in its native host, preserving hyperthermophilic adaptations .

What heterologous expression systems are suitable for recombinant MJ1308 production?

When native expression is challenging, heterologous systems offer alternatives:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, ease of useProtein misfolding, lack of archaeal post-translational modificationsCodon optimization, co-expression with chaperones, lower temperature induction
Yeast (S. cerevisiae, P. pastoris)Eukaryotic processing, higher folding fidelityLower yields than E. coliOptimize growth media, induction timing
Cell-free systemsAvoids toxicity issues, rapidExpensive, limited scaleSupplement with archaeal ribosomes/factors
Archaeal hosts (H. volcanii, T. kodakarensis)Similar cellular machineryLower yields, technical complexityOptimize promoters, culture conditions

For hyperthermophilic proteins like MJ1308, consider chaperone co-expression and thermostability-enhancing buffers. E. coli-based expression remains most common, but archaeal-specific features may necessitate specialized approaches .

What purification strategy should I employ for recombinant MJ1308?

A methodological purification approach includes:

  • Design constructs with appropriate affinity tags (His-tag, Strep-tag, or FLAG-tag) as demonstrated with other M. jannaschii proteins

  • Implement heat treatment (70-80°C) as initial purification step, exploiting thermostability of M. jannaschii proteins

  • Perform affinity chromatography under conditions that maintain protein stability

  • Consider size exclusion chromatography for higher purity

  • Verify protein identity using mass spectrometry and Western blot

  • Assess protein quality through circular dichroism and thermal shift assays

For hyperthermophilic proteins, include stabilizing agents (osmolytes, specific ions) in buffers throughout purification to maintain native conformation .

How can I determine the structural characteristics of MJ1308?

A comprehensive structural analysis workflow includes:

  • Computational structure prediction:

    • AlphaFold2/RoseTTAFold for initial model

    • Molecular dynamics simulations to assess stability

    • Domain identification using tools that identified domains in other uncharacterized archaeal proteins

  • Experimental structure determination:

    • X-ray crystallography (optimization of crystallization conditions for thermophilic proteins)

    • Cryo-EM for larger complexes

    • NMR for dynamic regions

  • Functional structure analysis:

    • Ligand binding prediction through virtual screening

    • Conservation analysis to identify functional residues

    • Protein-protein interaction prediction

Structure determination enables hypothesis generation about MJ1308 function based on structural homology to characterized proteins .

What approaches can reveal the biological function of MJ1308?

Function determination requires multiple complementary approaches:

  • Computational function prediction:

    • Gene neighborhood analysis

    • Co-expression patterns with known genes

    • Presence of conserved domains (similar to Mth938 domain identification)

  • Knockout/knockdown studies:

    • Gene deletion using the newly established genetic system for M. jannaschii

    • Phenotypic analysis under various conditions

  • Protein interaction studies:

    • Pull-down assays using affinity-tagged MJ1308

    • Crosslinking mass spectrometry

    • Yeast two-hybrid with archaeal library

  • Biochemical assays:

    • Substrate screening

    • Activity assays based on predicted function

    • Metabolomic profiling of knockout strains

This multifaceted approach proved successful for other M. jannaschii proteins like the FprA homologs (Mj_0732 and Mj_0748) .

How can I investigate MJ1308's potential role in M. jannaschii's adaptation to extreme environments?

Investigating environmental adaptation requires systematic approaches:

  • Expression profiling:

    • qRT-PCR analysis of MJ1308 under varying temperatures (48-94°C), pressures, and salinity conditions

    • Proteomics to quantify protein abundance changes

  • Stress response analysis:

    • Exposure to oxidative stress, similar to studies of FprA proteins

    • Heat shock experiments beyond optimal growth conditions

    • Nutrient limitation studies

  • Comparative genomics:

    • Analysis of MJ1308 conservation across extremophiles

    • Identification of co-evolving genes suggesting functional relationships

  • Structural adaptation assessment:

    • Molecular dynamics simulations at different temperatures

    • Analysis of thermostabilizing features in protein structure

These approaches can reveal whether MJ1308 contributes to M. jannaschii's remarkable ability to thrive in extreme deep-sea hydrothermal vent environments .

How can I evaluate MJ1308's potential involvement in M. jannaschii's energy metabolism?

As M. jannaschii derives energy solely from hydrogenotrophic methanogenesis, investigating MJ1308's role requires:

  • Metabolic context analysis:

    • Proximity to known methanogenesis genes

    • Differential expression during growth on CO2/H2

  • Enzymatic activity screening:

    • Testing for hydrogenase activity

    • Assessing interaction with methanogenic cofactors

    • Redox potential measurements

  • Metabolic flux analysis:

    • Isotope labeling studies in wildtype vs. MJ1308 mutants

    • Quantification of methanogenesis rates

  • Protein localization:

    • Membrane vs. cytoplasmic distribution

    • Association with known methanogenesis complexes

If MJ1308 contains domains similar to other redox proteins like FprA, it may participate in electron transfer pathways critical to M. jannaschii's ancient respiratory metabolism .

How should I address protein stability issues when working with recombinant MJ1308?

Stability challenges with thermophilic proteins expressed at mesophilic temperatures require:

  • Expression optimization:

    • Reducing expression temperature (15-18°C)

    • Adding stabilizing agents to media (osmolytes, specific ions)

    • Controlling induction rate with lower inducer concentrations

  • Purification considerations:

    • Rapid processing to minimize degradation

    • Including protease inhibitors optimized for thermophilic proteases

    • Maintaining higher temperatures during purification when possible

  • Storage stability:

    • Testing various buffer compositions

    • Evaluating cryoprotectants

    • Lyophilization optimization

  • Refolding strategies:

    • Heat activation steps (controlled heating to 60-80°C)

    • Chemical chaperoning with archaeal-specific cofactors

These strategies have proven effective for other M. jannaschii proteins that encounter stability challenges when manipulated at non-native temperatures .

How can I resolve contradictory results in MJ1308 functional studies?

Data inconsistencies require systematic troubleshooting:

  • Experimental validation:

    • Verify protein identity through mass spectrometry

    • Confirm structural integrity using circular dichroism

    • Ensure proper folding through activity controls

  • Condition-dependent effects:

    • Test function under varying temperatures, pH, and salt concentrations

    • Consider redox state and buffer components

    • Evaluate cofactor requirements

  • Statistical analysis:

    • Apply appropriate statistical tests to experimental data

    • Consider biological vs. technical replicates

    • Perform power analysis to determine adequate sample size

  • Integrative analysis:

    • Cross-validate results using multiple techniques

    • Evaluate consistency with evolutionary expectations

    • Compare with data from better-characterized homologs

When working with uncharacterized proteins like MJ1308, apparently contradictory results often reflect condition-dependent functions or multiple biochemical activities, as observed with multifunctional proteins like the F420-dependent sulfite reductase in M. jannaschii .

What experimental design approaches help resolve whether MJ1308 contains a functional domain similar to Mth938?

To determine domain functionality in MJ1308:

  • Domain-focused mutational analysis:

    • Site-directed mutagenesis of conserved residues

    • Truncation constructs to isolate potential domains

    • Chimeric proteins swapping domains with characterized proteins

  • Comparative biochemistry:

    • Side-by-side activity assays with known Mth938-domain proteins

    • Substrate competition experiments

    • Inhibitor sensitivity profiles

  • Structural confirmation:

    • Domain-specific labeling for structural studies

    • Hydrogen-deuterium exchange mass spectrometry

    • Conformational antibodies recognizing specific domain states

  • Biophysical characterization:

    • Thermal shift assays with potential ligands

    • Isothermal titration calorimetry for binding constants

    • Surface plasmon resonance for interaction kinetics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.