Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1310 (MJ1310)

What is known about the primary structure of MJ1310?

MJ1310 is an uncharacterized protein from Methanocaldococcus jannaschii consisting of 128 amino acids. The complete amino acid sequence is: MIMINYLVNRMDFQMASFITSGLLVIIGLYGVFFVDNVLKKIIALEILGSGVNLALIAIGYNGGTIPIKLPGVSVEVFAKESAYPLTHALVLTNIVIEASMLAVMLGVSIILYKKYKTLRSSVILKED . Analysis of this sequence reveals significant hydrophobic regions, particularly in the N-terminal half, suggesting potential membrane association or transmembrane domains. The protein has been assigned the UniProt ID Q58706 .

What physical and chemical properties can be predicted for MJ1310?

Based on the amino acid composition, MJ1310 likely has hydrophobic properties consistent with membrane proteins. The presence of multiple hydrophobic amino acid stretches (particularly the regions with leucine, isoleucine, and valine residues) suggests it may be integrated into or associated with cellular membranes. The protein likely maintains stability at high temperatures, given that M. jannaschii is a hyperthermophilic organism that grows optimally around 85°C. Computational analysis would predict multiple transmembrane helices within the sequence, which is consistent with the amino acid distribution pattern observed.

How should researchers approach initial characterization of this uncharacterized protein?

A systematic approach beginning with bioinformatic analysis would be most efficient. This should include:

• Sequence homology searches across multiple databases to identify potential related proteins

• Secondary structure prediction using algorithms such as PSIPRED or JPred

• Topology prediction for potential transmembrane regions using TMHMM or TOPCONS

• Domain and motif identification using InterPro or PROSITE

• Phylogenetic analysis to understand evolutionary relationships

Following computational analysis, experimental characterization should include expression testing, solubility assessment, and basic biochemical characterization (molecular weight confirmation, oligomeric state determination, and thermal stability analysis).

What expression systems have been successfully used for MJ1310?

The E. coli expression system has been successfully employed to produce recombinant MJ1310 with an N-terminal His-tag . When designing expression strategies for archaeal proteins in bacterial hosts, researchers should consider codon optimization to account for the different codon usage preferences between archaea and bacteria. Additionally, the growth temperature should be optimized, potentially using lower temperatures during induction to improve protein folding, despite M. jannaschii being a thermophile.

What purification strategies are recommended for isolating high-purity MJ1310?

Since recombinant MJ1310 can be produced with an N-terminal His-tag, immobilized metal affinity chromatography (IMAC) is the recommended initial purification step . For higher purity, additional chromatographic steps might include:

• Ion exchange chromatography - particularly useful if isoelectric point (pI) prediction suggests the protein has a strong charge at physiological pH

• Size exclusion chromatography - for final polishing and to assess oligomeric state

• Hydrophobic interaction chromatography - may be particularly useful given the hydrophobic nature of the protein

Purification buffers should contain appropriate stabilizing components, potentially including mild detergents if the protein has membrane-associating properties.

What are the optimal storage conditions for maintaining MJ1310 stability?

According to documented protocols, recombinant MJ1310 is supplied as a lyophilized powder and should be stored at -20°C to -80°C . For reconstitution, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, adding glycerol to a final concentration of 50% and storing at -20°C/-80°C is recommended. Working aliquots can be maintained at 4°C for up to one week . Repeated freeze-thaw cycles should be avoided to prevent protein degradation and loss of potential activity.

How might researchers determine the cellular localization of MJ1310?

Given the hydrophobic regions in MJ1310's sequence, determining its cellular localization would provide valuable functional insights. A multi-faceted approach could include:

• Subcellular fractionation of M. jannaschii cells followed by western blotting using anti-MJ1310 antibodies

• Immunogold electron microscopy for precise localization

• Heterologous expression of fluorescently-tagged MJ1310 in genetically tractable archaeal hosts

• Membrane integration analysis using alkaline extraction or protease protection assays

• Liposome association studies with purified recombinant protein

The predicted transmembrane nature of the protein suggests membrane localization, but experimental verification is essential.

What approaches can be used to identify potential interaction partners?

For an uncharacterized protein like MJ1310, identifying interaction partners can provide crucial functional insights. Recommended methods include:

• Affinity purification coupled with mass spectrometry (AP-MS) using His-tagged MJ1310 as bait

• Yeast two-hybrid screening against an archaeal protein library

• Proximity-dependent biotin identification (BioID) in heterologous systems

• Cross-linking mass spectrometry to capture transient interactions

• Co-immunoprecipitation studies from native M. jannaschii extracts

When designing these experiments, consideration should be given to the native environment of M. jannaschii, including temperature and salt concentrations that might affect protein-protein interactions.

How can genomic context analysis assist in functional prediction?

Genomic context analysis can provide valuable clues about MJ1310's function by examining:

• Gene neighborhood - identifying consistently co-located genes across multiple species

• Gene fusion events - checking if MJ1310 homologs appear as domains within larger proteins in other organisms

• Phylogenetic profiling - identifying genes with similar evolutionary distribution patterns

• Co-expression data - analyzing transcriptomic datasets to find genes with similar expression patterns

This approach has proven particularly useful for archaeal proteins, where experimental characterization may be limited but genomic data is abundant.

What structural biology techniques would be most suitable for MJ1310?

Given the predicted membrane-associated nature of MJ1310, structural determination presents particular challenges. The most appropriate techniques would be:

• X-ray crystallography - requiring detergent screening for solubilization and crystallization

• Cryo-electron microscopy - particularly suited for membrane proteins

• Nuclear magnetic resonance (NMR) spectroscopy - useful for dynamic regions and smaller protein domains

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS) - for mapping solvent-accessible regions and conformational dynamics

For initial structural insights, circular dichroism spectroscopy could provide information about secondary structure content and thermal stability.

How should researchers approach crystallization of a potentially membrane-associated protein like MJ1310?

Crystallization of membrane-associated proteins requires specialized approaches:

• Detergent screening to identify optimal solubilization conditions

• Lipidic cubic phase (LCP) crystallization methods

• Use of crystallization chaperones such as antibody fragments

• Consideration of polymer-based systems like nanodiscs or amphipols

• Screening for stabilizing additives that maintain native conformation

The use of truncated constructs focusing on soluble domains might also be considered if full-length crystallization proves challenging.

What computational approaches might complement experimental structural studies?

While experimental structure determination should be pursued, computational methods can provide valuable insights:

• Homology modeling - if structurally characterized homologs exist

• Ab initio modeling using methods like AlphaFold or RoseTTAFold

• Molecular dynamics simulations to study conformational dynamics and membrane interactions

• Sequence-based topology prediction to guide experimental design

• Conservation mapping to identify functionally important residues

These computational approaches can guide experimental design and provide testable hypotheses about structure-function relationships.

How does MJ1310 compare to other characterized proteins from M. jannaschii?

Comparative analysis with other M. jannaschii proteins, particularly those with known functions, can provide context for understanding MJ1310. For example, MJ1099 has been characterized as involved in the biosynthesis of tetrahydromethanopterin and methanofuran, key cofactors in one-carbon metabolism in methanogenic archaea . Its structure has been solved to 1.7 Å resolution, revealing it as a member of the TIM-barrel superfamily and a homohexamer . While MJ1310 and MJ1099 may not share sequence similarity, examining the general principles of protein structure and function in M. jannaschii can inform approaches to MJ1310 characterization.

What can the study of MJ1310 contribute to our understanding of archaeal biology?

Characterizing uncharacterized proteins like MJ1310 is critical for expanding our understanding of archaeal biology in several ways:

• Identifying novel protein families and functions unique to archaea

• Understanding adaptations to extreme environments, particularly high temperatures

• Elucidating archaeal-specific metabolic pathways and cellular processes

• Providing insights into archaeal membrane organization and dynamics

• Contributing to evolutionary understanding of the archaeal domain of life

The presence of homologs across multiple archaeal species would suggest an important conserved function, making MJ1310 a valuable target for advancing archaeal biology.

How might thermal adaptation be reflected in MJ1310's structure?

As a protein from a hyperthermophilic organism, MJ1310 likely incorporates several adaptations for thermal stability:

• Increased hydrophobic core packing

• Higher proportion of charged residues forming salt bridges

• Shorter surface loops vulnerable to thermal denaturation

• Potentially increased disulfide bonding (if cysteine residues are present)

• Greater structural rigidity in regions critical for function

Comparative analysis with homologs from mesophilic archaea could highlight specific adaptations to the extreme thermal environment of M. jannaschii.

What genetic tools could be applied to study MJ1310 function in vivo?

• Development of CRISPR-Cas9 systems adapted for hyperthermophilic archaea

• Gene silencing using antisense RNA approaches

• Heterologous expression in more genetically tractable archaeal hosts like Thermococcus kodakarensis

• Complementation studies in related archaeal species with MJ1310 homologs

• In vitro transcription-translation systems using M. jannaschii extracts

These approaches would need to be optimized for the specific challenges of working with hyperthermophilic organisms.

How might high-throughput screening approaches be applied to MJ1310 functional characterization?

High-throughput approaches can accelerate functional discovery for uncharacterized proteins like MJ1310:

• Activity-based protein profiling with diverse chemical probes

• Substrate library screening for potential enzymatic activities

• Differential scanning fluorimetry with metabolite libraries to identify potential ligands

• Microarray-based interaction screens with cellular extracts

• Phenotypic screening of heterologous expression in model organisms

These approaches cast a wide net for potential functions and can identify unexpected activities that targeted approaches might miss.

What considerations are important when designing inhibitors or modulators of MJ1310?

While MJ1310's function remains uncharacterized, developing molecular probes could accelerate functional studies. Key considerations include:

• Targeting highly conserved regions identified through sequence alignment of homologs

• Design of photoaffinity probes for identifying binding sites

• Fragment-based approaches to identify initial binding modules

• Consideration of the hyperthermophilic nature of the native protein

• Potential membrane association requiring lipophilic properties

By analogy, this approach has been suggested for other archaeal proteins, such as MJ1099, where inhibitor development could target methanogenic archaea that produce greenhouse gases .

What is the potential significance of MJ1310 in the context of methanogenesis?

While direct evidence linking MJ1310 to methanogenesis is currently lacking, its investigation in this context is warranted:

• Methanogenesis is the defining metabolic pathway of M. jannaschii

• Many membrane proteins in methanogens are involved in energy conservation

• The transmembrane nature of MJ1310 suggests potential roles in ion transport or membrane-associated metabolic processes

• Uncharacterized proteins often represent missing links in established metabolic pathways

Investigation of MJ1310 in relation to methanogenesis could provide new insights into this environmentally and biotechnologically important process.

How might MJ1310 studies contribute to biotechnological applications?

Understanding MJ1310 could have several biotechnological implications:

• Development of thermostable proteins for industrial processes

• Insights into membrane protein stability at extreme temperatures

• Potential applications in methane mitigation strategies if involved in methanogenesis

• Discovery of novel enzymatic activities with biotechnological value

• Structural principles that could inform protein engineering for thermal stability

The extreme environment adaptation of archaeal proteins makes them particularly valuable in biotechnological applications requiring stability under harsh conditions.

What interdisciplinary approaches might accelerate MJ1310 characterization?

Given the challenges in characterizing archaeal proteins, interdisciplinary approaches are particularly valuable:

• Integration of bioinformatics, structural biology, and biochemistry

• Application of systems biology approaches to place MJ1310 in metabolic context

• Combination of classical biochemistry with advanced imaging techniques

• Leveraging synthetic biology tools for functional reconstitution

• Application of evolutionary biology concepts to understand conservation patterns

Collaborative approaches combining these disciplines are most likely to yield comprehensive insights into the function of this uncharacterized protein.

What are common challenges in expressing archaeal membrane proteins and how can they be addressed?

Expression of archaeal membrane proteins presents specific challenges:

• Codon bias differences between archaeal and bacterial expression hosts

• Membrane insertion machinery differences affecting proper folding

• Different lipid composition affecting stability

• Potential toxicity to host cells

• Differences in post-translational modifications

Strategies to address these challenges include using specialized expression strains, employing fusion partners to enhance solubility, optimizing growth conditions, and considering cell-free expression systems for toxic proteins.

How can researchers distinguish between experimental artifacts and genuine protein properties when working with MJ1310?

When characterizing an uncharacterized protein like MJ1310, distinguishing artifacts from genuine properties requires:

• Using multiple complementary experimental approaches

• Including appropriate positive and negative controls

• Comparing native and recombinant protein properties where possible

• Validating functional findings under physiologically relevant conditions

• Confirming specific effects through mutation of key residues

The use of tag-free protein preparations alongside tagged versions can help identify tag-related artifacts that might confound interpretation.

What quality control measures are essential when working with recombinant MJ1310?

To ensure reliable and reproducible results, quality control should include:

• Purity assessment by SDS-PAGE and mass spectrometry

• Confirmation of correct folding through circular dichroism or other spectroscopic techniques

• Activity retention verification if functional assays become available

• Stability assessment under experimental conditions

• Batch-to-batch consistency testing

For membrane-associated proteins like MJ1310, detergent composition and concentration should be carefully monitored as they significantly impact protein behavior.