Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1333.1 (MJ1333.1)

Shipped with Ice Packs
In Stock

Description

Overview of MJ1333.1

MJ1333.1 is annotated as an uncharacterized protein belonging to the EamA family of transporters, which are implicated in small-molecule transport across membranes . The gene encoding this protein, MJ1333.1, is part of the M. jannaschii genome sequenced in 1996 , but its precise biochemical role remains unresolved. Recombinant versions of MJ1333.1 are produced for structural and functional studies, leveraging its thermostable properties for industrial or biotechnological applications .

Key Features

PropertyDetails
Gene NameMJ1333.1
UniProt IDP81327
Protein LengthPartial sequence (exact residues unspecified)
Expression HostEscherichia coli
TagHis-tag (position varies based on construct)
Purity≥85% (SDS-PAGE)
StorageLyophilized or in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -20°C/-80°C

Sequence Information

The partial amino acid sequence of recombinant MJ1333.1 has not been fully disclosed in public databases, but its coding region is located on the main chromosome of M. jannaschii . Homology searches indicate it lacks significant similarity to proteins in other organisms, suggesting a unique archaeal function .

Recombinant Production and Purification

Recombinant MJ1333.1 is typically expressed in E. coli systems due to their cost-effectiveness and scalability. Key steps include:

  • Cloning: The MJ1333.1 gene is inserted into expression vectors with promoter systems optimized for high yield .

  • Purification: Affinity chromatography (e.g., nickel-nitrilotriacetic acid resins) is used to isolate the His-tagged protein .

  • Reconstitution: The protein is solubilized in Tris/PBS-based buffers with glycerol (5–50%) to enhance stability .

Research Applications and Challenges

  • Hypothesized Function: As an EamA family member, MJ1333.1 may participate in transport processes, potentially involving sulfur-containing compounds or other small molecules .

  • Structural Studies: Its thermostability makes it a candidate for crystallography or cryo-EM to resolve 3D structures .

  • Biotechnological Potential: Could serve as a scaffold for engineering thermostable enzymes or biosensors .

Limitations

  • The lack of full-length sequence data and functional assays hinders mechanistic insights .

  • No peer-reviewed studies directly linking MJ1333.1 to specific metabolic pathways are available .

Genomic and Evolutionary Context

  • Genomic Position: Located on the main chromosome of M. jannaschii (DSM 2661) .

  • Conservation: Limited to methanogenic archaea, including Methanopyrus kandleri and Methanothermobacter thermautotrophicus, suggesting a niche role in methanogenesis .

  • Patent Relevance: MJ1333.1 is listed in early patents describing M. jannaschii genome-derived ORFs for industrial enzyme discovery .

Future Directions

  • Functional Characterization: Knockout studies in M. jannaschii could elucidate its role in vivo .

  • Proteomic Profiling: Interaction studies may identify binding partners or substrates .

  • Synthetic Biology: Engineering MJ1333.1 into synthetic pathways for extreme-condition biocatalysis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we can accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize development of the specified tag if possible.
Synonyms
MJ1333.1; Uncharacterized protein MJ1333.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1333.1
Target Protein Sequence
MDTAIILGLLVAVFYGVGTFFAKIVCEKNPLFQWIVVNIVGIILCLIILLKYKNIIITDQ KILTYAIISAVLVVIGSLLLYYALYKGKASIVVPLSSIGPAITVALSILFLKETLTLPQM IGIVLIIIGIILLSISN
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of MJ1333.1 in Methanocaldococcus jannaschii?

MJ1333.1 is one of the open reading frames (ORFs) identified in the complete 1.66-megabase pair genome sequence of Methanocaldococcus jannaschii, an autotrophic archaeon. The genomic context includes regulatory elements such as expression modulating fragments (EMFs) that are located 5' to the ORF and can modulate the expression of operably linked sequences. Understanding this genomic architecture is essential for designing recombinant constructs and expression systems for functional studies of this uncharacterized protein .

What approaches should be used for initial sequence analysis of MJ1333.1?

  • Identification of conserved domains

  • Prediction of tertiary structure

  • Alignment with characterized proteins from related organisms

  • Assessment of critical functional residues

These steps help generate initial hypotheses about protein function that can guide subsequent experimental design. When analyzing tertiary structure, it's important to remember that some amino acid sequences can be varied without significant effect on structure or function, particularly in non-critical regions of the protein .

What expression systems are recommended for recombinant production of MJ1333.1?

For recombinant production of MJ1333.1, a systematic experimental approach is required. The process involves:

Expression SystemAdvantagesChallengesRecommended Applications
E. coliHigh yield, rapid growth, well-established protocolsPotential protein folding issues with archaeal proteinsInitial protein production, mutagenesis studies
Yeast systemsBetter post-translational modificationsLower yield than bacterial systemsFunctional studies requiring eukaryotic-like modifications
Cell-free systemsAvoids toxicity issues, rapidHigher cost, lower scalePreliminary functional characterization
Archaeal host systemsNative folding environmentTechnical challenges, slower growthDefinitive structural and functional studies

The experimental approach should begin with vector construction incorporating the MJ1333.1 ORF and appropriate regulatory elements. The vector is then transformed into an appropriate host using established procedures, and the phenotype of the transformed host examined under suitable conditions. For archaeal proteins like MJ1333.1, special attention should be paid to codon optimization and temperature conditions, as M. jannaschii is a thermophilic organism .

How should I design experiments to characterize the function of MJ1333.1?

Designing experiments to characterize the function of an uncharacterized protein like MJ1333.1 requires a systematic approach following key experimental design principles:

  • Define your variables clearly:

    • Independent variable: Different experimental conditions (temperature, substrates, cofactors)

    • Dependent variable: Measurable protein activities or properties

    • Control variables: pH, buffer composition, protein concentration

  • Develop specific, testable hypotheses based on sequence analysis and predicted structure

  • Design experimental treatments with appropriate controls:

    • Positive controls with known protein functions

    • Negative controls without protein or with denatured protein

    • Concentration gradients to establish dose-response relationships

  • Plan measurements with appropriate techniques:

    • Spectroscopic methods for binding studies

    • Enzymatic assays if catalytic activity is suspected

    • Structural analysis via crystallography or NMR

What are the best approaches to study protein-protein interactions involving MJ1333.1?

To study protein-protein interactions involving MJ1333.1, multiple complementary methodologies should be employed:

MethodPrincipleAdvantagesLimitationsData Analysis Approach
Yeast Two-HybridTranscriptional activation when proteins interactIn vivo detection, high-throughputFalse positives, requires nuclear localizationStatistical analysis of reporter gene expression
Co-immunoprecipitationAntibody-based pull-down of protein complexesDetects native complexesRequires specific antibodies, may disrupt weak interactionsWestern blot quantification, mass spectrometry identification
Surface Plasmon ResonanceDetection of binding via refractive index changesReal-time kinetics, label-freeRequires protein immobilizationCurve fitting to association/dissociation models
Fluorescence Resonance Energy TransferEnergy transfer between fluorophores when proteins are in proximityCan detect interactions in living cellsRequires fluorescent taggingRatiometric analysis of donor/acceptor emission

When designing these experiments, consider the thermophilic nature of M. jannaschii and adjust experimental conditions accordingly. Initial screens should be performed under varying salt concentrations and temperatures to identify optimal conditions for interaction. Data from multiple methods should be integrated to build a comprehensive interaction model .

How can I design experiments to determine the subcellular localization of MJ1333.1?

Determining the subcellular localization of MJ1333.1 requires specialized approaches due to its archaeal origin. The experimental design should include:

  • Bioinformatic prediction using archaeal-specific algorithms to identify potential localization signals

  • Fluorescent tagging approaches:

    • C-terminal and N-terminal GFP fusions to determine if terminal tags affect localization

    • Split-GFP complementation to verify exposure to cellular compartments

    • Temperature-stable fluorescent proteins appropriate for thermophilic conditions

  • Immunolocalization studies:

    • Generation of specific antibodies against MJ1333.1

    • Fixation and permeabilization protocols optimized for archaeal cell architecture

    • Co-localization with known archaeal compartment markers

  • Subcellular fractionation:

    • Membrane vs. cytosolic fractionation

    • Density gradient separation of cellular components

    • Western blot analysis of fractions

The experimental design should include appropriate controls and statistical analysis to quantify the distribution patterns observed. Additionally, consider time-course experiments to detect potential changes in localization under different growth conditions or stress responses .

What statistical approaches are appropriate for analyzing MJ1333.1 functional data?

When analyzing functional data for MJ1333.1, the statistical approach should match the experimental design and data characteristics:

  • Initial data exploration:

    • Descriptive statistics (mean, median, standard deviation)

    • Data visualization through scatter plots and histograms

    • Assessment of data distribution normality

  • For enzymatic activity or binding studies:

    • Regression analysis to model relationships between variables

    • Non-linear curve fitting for kinetic parameters

    • Analysis of variance (ANOVA) to compare multiple conditions

  • For high-throughput screening data:

    • Multiple hypothesis testing with appropriate corrections (e.g., Bonferroni)

    • Cluster analysis to identify patterns in large datasets

    • Principal component analysis to reduce dimensionality

  • Data transformation considerations:

    • Log transformation for severely non-normal distributions

    • Square root transformation for moderately non-normal distributions

    • Categorical transformations when appropriate

  • Validation approaches:

    • Cross-validation to test model stability

    • Bootstrapping for robust confidence intervals

    • Sensitivity analysis to assess parameter influence

How should I approach contradictory results in MJ1333.1 characterization experiments?

When faced with contradictory results in MJ1333.1 characterization experiments, a systematic troubleshooting and reconciliation approach is essential:

  • Data quality assessment:

    • Review raw data for quality issues or artifacts

    • Check for batch effects or systematic biases

    • Verify instrument calibration and reagent integrity

  • Methodological considerations:

    • Compare experimental conditions between contradictory experiments

    • Evaluate buffer compositions, temperature, and pH differences

    • Assess protein quality and potential degradation

  • Biological explanations:

    • Consider post-translational modifications

    • Evaluate oligomerization states

    • Examine potential allosteric regulation

  • Resolution strategies:

    • Perform orthogonal experiments using complementary techniques

    • Modify experimental conditions systematically to identify critical variables

    • Use computational modeling to generate hypotheses about contradictions

  • Statistical approaches:

    • Meta-analysis of multiple experiments

    • Bayesian methods to incorporate prior knowledge

    • Sensitivity analysis to identify influential parameters

Document all contradictions and resolution attempts meticulously. In many cases, apparent contradictions lead to deeper understanding of complex protein behavior when properly investigated .

What approaches should be used to compare MJ1333.1 with homologous proteins from other species?

Comparing MJ1333.1 with homologous proteins requires a multi-faceted approach combining sequence, structure, and functional analyses:

Analysis LevelMethodsKey MetricsInterpretation Approach
SequenceMultiple sequence alignment, Phylogenetic analysisPercent identity, Conservation scores, Evolutionary distanceIdentify conserved domains, functional motifs, and species-specific variations
StructureHomology modeling, Structural alignmentRMSD values, TM-scores, Superposition qualityCompare folding patterns, binding pockets, and surface properties
FunctionComparative biochemistry, Complementation assaysKinetic parameters, Substrate specificity, In vivo activityAssess functional conservation and divergence across species

The analysis should begin with exploratory approaches to identify patterns, followed by confirmatory analyses to test specific hypotheses about evolutionary relationships. When interpreting results, consider:

  • The evolutionary distance between species

  • Environmental adaptations (thermophilic vs. mesophilic)

  • Potential moonlighting functions

  • Convergent evolution possibilities

Use statistical approaches such as principal component analysis to visualize relationships between multiple proteins and identify clustering patterns. When possible, integrate experimental data with computational predictions to build comprehensive comparison models .

How can gene editing tools be optimized for modifying MJ1333.1 in its native context?

Optimizing gene editing tools for archaeal systems requires specialized approaches:

  • CRISPR-Cas system adaptation:

    • Engineer thermostable Cas9 variants for M. jannaschii's growth temperature

    • Design guide RNAs with high specificity to MJ1333.1 locus

    • Develop archaeal-specific delivery systems

  • Homologous recombination strategies:

    • Design extended homology arms (>1kb) for precise integration

    • Optimize selection markers for archaeal systems

    • Establish counter-selection methods for marker removal

  • Expression modulation approaches:

    • Engineer inducible promoter systems functional in archaea

    • Design translational control elements for expression fine-tuning

    • Develop antisense RNA strategies for knockdown experiments

  • Validation and screening methods:

    • Establish PCR-based screening protocols for integration events

    • Develop whole-genome sequencing approaches to verify off-target effects

    • Implement phenotypic screens relevant to predicted MJ1333.1 function

When designing experimental controls, include wild-type strains, strains with edited non-functional genes, and complementation strains. For quantitative analysis, measure editing efficiency using next-generation sequencing approaches and analyze the data using appropriate statistical methods for rare event detection .

What approaches are recommended for solving the crystal structure of MJ1333.1?

Solving the crystal structure of MJ1333.1 requires a comprehensive experimental strategy:

  • Protein production optimization:

    • Test multiple expression constructs with varying tags and fusion partners

    • Optimize purification protocols for homogeneity and stability

    • Implement quality control via SEC-MALS and thermal shift assays

  • Crystallization screening:

    • Employ sparse matrix screens at temperatures relevant to thermophilic proteins

    • Test multiple protein concentrations and buffer conditions

    • Explore co-crystallization with potential cofactors or ligands

  • Data collection strategies:

    • Consider selenium-methionine labeling for phase determination

    • Plan synchrotron access for high-resolution data

    • Implement data collection at multiple temperatures

  • Structure solution approaches:

    • Molecular replacement if homologous structures exist

    • Experimental phasing methods (SAD/MAD) if novel fold is expected

    • Ab initio methods for smaller domains

  • Validation and refinement:

    • Rigorous geometric and stereochemical validation

    • Omit map calculation for uncertain regions

    • Multiple refinement strategies including simulated annealing

Data analysis should include statistical evaluation of diffraction data quality, assessment of model bias, and comprehensive validation using tools like MolProbity. For difficult cases, consider complementary structural approaches such as cryo-EM or NMR spectroscopy to provide additional constraints .

How can systems biology approaches be applied to understand MJ1333.1's role in M. jannaschii's metabolic network?

Integrating MJ1333.1 into a systems biology framework requires multi-omics approaches:

  • Network reconstruction:

    • Generate protein-protein interaction networks through high-throughput methods

    • Develop metabolic models incorporating potential MJ1333.1 functions

    • Map transcriptional responses to MJ1333.1 perturbation

  • Multi-omics integration:

    • Correlate transcriptomics data with proteomics after MJ1333.1 manipulation

    • Implement metabolomics to detect changes in metabolite pools

    • Apply lipidomics if membrane association is suspected

  • Computational modeling:

    • Develop constraint-based models (e.g., flux balance analysis)

    • Implement kinetic models if enzymatic function is established

    • Create regulatory network models incorporating MJ1333.1

  • Experimental validation:

    • Design targeted metabolic interventions based on model predictions

    • Implement synthetic biology approaches to test essentiality

    • Perform competition experiments under varying conditions

Analysis should integrate multiple data types using statistical approaches such as Bayesian networks, machine learning algorithms, or correlation-based methods. When interpreting results, consider the unique characteristics of archaeal systems and the potential for MJ1333.1 to be involved in archaeal-specific pathways not present in better-characterized model organisms .

What are the most promising future research directions for MJ1333.1 characterization?

The comprehensive characterization of MJ1333.1 opens several promising research avenues:

  • Structural biology approaches:

    • High-resolution structure determination

    • Dynamics studies using hydrogen-deuterium exchange

    • Conformational analysis using single-molecule techniques

  • Functional genomics:

    • CRISPR interference in native host

    • Transposon mutagenesis screens

    • Synthetic genetic array analysis

  • Evolutionary insights:

    • Ancestral sequence reconstruction

    • Horizontal gene transfer investigation

    • Adaptive evolution experiments

  • Biotechnological applications:

    • Enzyme engineering for enhanced thermostability

    • Development as research tools for molecular biology

    • Exploration of catalytic activities for biocatalysis

These directions should be prioritized based on preliminary data and available resources. A strategic research program would begin with structural characterization to inform subsequent functional studies, followed by systems-level analyses to place findings in broader biological context .

How can contradictory findings about MJ1333.1 be reconciled through meta-analysis?

Meta-analysis of contradictory findings requires a structured approach:

  • Systematic literature review:

    • Comprehensive database searching

    • Inclusion/exclusion criteria development

    • Quality assessment of individual studies

  • Data extraction and standardization:

    • Convert results to comparable metrics

    • Account for methodological differences

    • Standardize experimental conditions when possible

  • Statistical integration:

    • Fixed-effects or random-effects models depending on heterogeneity

    • Subgroup analysis to identify sources of variation

    • Meta-regression to identify explanatory variables

  • Publication bias assessment:

    • Funnel plot analysis

    • Egger's test for small-study effects

    • Trim-and-fill method for bias correction

  • Sensitivity analysis:

    • Leave-one-out analysis

    • Cumulative meta-analysis

    • Alternative statistical model testing

The meta-analysis should explicitly address heterogeneity between studies and propose biological or methodological explanations for observed differences. Results should be presented with appropriate forest plots and quantitative measures of effect sizes and confidence intervals .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.