Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1354 (MJ1354)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Methanocaldococcus jannaschii Uncharacterized Protein MJ1354 (MJ1354) is a protein that, as the name suggests, has not yet been fully characterized . The term "recombinant" indicates that the protein is produced using genetic engineering techniques, typically in a host organism like E. coli . The MJ1354 protein is native to Methanocaldococcus jannaschii, an archaeon .

Table 1: MJ1354 General Information

AttributeDescription
Full NameRecombinant Full Length Methanocaldococcus jannaschii Uncharacterized Protein Mj1354(Mj1354)
Source HostE. coli
SpeciesMethanocaldococcus jannaschii
TagHis-Tagged
Protein LengthFull Length (1-145)
AbbreviationMJ1354
UniProt IDQ58749

Production and Characteristics

MJ1354 is often produced in E. coli as a recombinant protein with a His-tag for purification purposes . The His-tag allows for easy isolation of the protein via affinity chromatography . The recombinant MJ1354 protein is available commercially, typically in a lyophilized form, and can be reconstituted for experimental use .

Table 2: Production and Biochemical Features

FeatureDescription
Host SystemE. coli
TagHistidine (His) tag
Purity>85% by SDS-PAGE
FormLyophilized powder
ReconstitutionRecommended in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage
Storage Temperature-20°C/-80°C
Shelf LifeLiquid form: 6 months at -20°C/-80°C; Lyophilized form: 12 months at -20°C/-80°C

Potential Functions and Pathways

While MJ1354 is currently annotated as an uncharacterized protein, bioinformatics analyses can provide clues regarding its potential functions. MJ1354 is predicted to participate in various pathways and molecular functions, potentially interacting with other proteins within Methanocaldococcus jannaschii . Further studies, such as structural analysis and interactome mapping, could elucidate its specific roles .

Research Applications

Recombinant MJ1354 can be utilized in various research applications:

  1. Protein Structure and Function Studies: Investigating the three-dimensional structure of MJ1354 through X-ray crystallography or NMR spectroscopy to understand its potential function .

  2. Interaction Studies: Identifying interacting partners of MJ1354 using techniques such as yeast two-hybrid assays or co-immunoprecipitation to map its position in cellular pathways .

  3. In vitro Assays: Performing in vitro biochemical assays to determine its enzymatic activity, if any .

  4. Antibody Production: Generating antibodies against MJ1354 for use in Western blotting and immunofluorescence to study its expression and localization within Methanocaldococcus jannaschii .

Genetic System Development

Developing genetic systems for M. jannaschii is crucial for studying proteins like MJ1354 . These systems allow researchers to create mutants and facilitate protein purification, which is essential for understanding the physiological roles and metabolic mechanisms of the organism .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
MJ1354; Uncharacterized protein MJ1354
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1354
Target Protein Sequence
MDVGIILGILSAMGFLVFLGIGGHILIGYEIIRKISKAYEKGEDVKELENKIINKSHLTN TLEKITTFTLTSIFLFEMEKYRYVIDVGYSILFLVTLTLYLVPNLSLLVWVTFFGATVFM IMLWILRFRAIKEFNKAFIEELTTQ
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1354

STRING: 243232.MJ_1354

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for protein research?

Methanocaldococcus jannaschii is a thermophilic methanogenic archaeon that grows by producing methane as a metabolic byproduct. It is historically significant as the first archaeal organism to have its genome completely sequenced in 1996, marking a milestone in archaeal genomics . The organism's genome consists of a large circular chromosome (1.66 mega base pairs) with a G+C content of 31.4%, plus large and small circular extra-chromosomes .

M. jannaschii has several key research implications:

  • It served as evidence for the three-domain classification of life (Bacteria, Archaea, and Eukarya)

  • Its hyperthermophilic enzymes provide valuable insights into enzyme evolution and catalytic mechanisms

  • It serves as a model organism for studying archaeal biochemistry and unique metabolic pathways

  • It contains numerous uncharacterized proteins including MJ1354, presenting opportunities for novel functional discoveries

The organism can only grow using carbon dioxide and hydrogen as primary energy sources, unlike other methanococci that can also utilize formate . This specialized metabolism makes its proteome particularly interesting for researchers studying unique archaeal adaptations.

What is currently known about the MJ1354 protein?

MJ1354 is classified as an uncharacterized protein in Methanocaldococcus jannaschii. According to protein databases, it is a relatively small protein consisting of 145 amino acids in its full-length form . The protein has been successfully expressed in recombinant form using E. coli expression systems and is commercially available with His-tag modifications for purification purposes .

Despite being categorized as "uncharacterized," certain basic properties are documented:

PropertyInformationSource
Protein LengthFull Length (1-145 amino acids)
Expression SystemE. coli
Tag OptionsHis-tagged
Source OrganismMethanocaldococcus jannaschii DSM 2661

The functional characteristics, enzymatic activity, cellular localization, and biological role of MJ1354 remain largely undefined, making it a candidate for fundamental research into archaeal protein function. Recent metabolic reconstruction efforts through the MjCyc pathway-genome database project may provide additional context for understanding this protein's potential role in the archaeal cell .

What experimental design approach is most appropriate for studying uncharacterized proteins like MJ1354?

When investigating uncharacterized proteins like MJ1354, a systematic experimental design is crucial. The most effective approach involves a multi-stage experimental framework:

Stage 1: Initial Characterization (Between-Subjects Design)

  • Begin with comparative analyses using both the target protein and appropriate controls

  • Implement a randomized controlled design where different treatment conditions are applied to the protein sample

  • Include positive controls (well-characterized proteins with known functions) and negative controls (buffer-only or irrelevant protein samples)

Stage 2: Function Prediction (Systematic Testing)

  • Apply a factorial experimental design to test multiple variables simultaneously

  • Test the protein under various conditions (temperature, pH, cofactors, potential substrates)

  • Measure dependent variables that might indicate function (substrate conversion, binding affinities, structural changes)

Stage 3: Validation (Within-Subjects Design)

  • Once potential functions are identified, apply a crossover experimental design where the same protein samples are tested under different conditions

  • This reduces variability due to sample preparation differences and increases statistical power

For all stages, follow these key experimental design principles:

  • Clearly define your independent variables (treatment conditions) and dependent variables (measurable outcomes)

  • Control extraneous variables through standardized protocols

  • Establish appropriate statistical methods for data analysis before experiments begin

  • Include biological and technical replicates to assess reliability

This approach maximizes the chances of detecting a functional signal against the background of experimental noise—particularly important when working with proteins of unknown function where effect sizes may be subtle .

How can I design experiments to detect potential enzymatic activity in MJ1354?

Detecting enzymatic activity in an uncharacterized protein like MJ1354 requires a systematic experimental approach:

Bioinformatic Analysis-Guided Screening

  • Begin with computational predictions based on sequence similarities, structural motifs, and genomic context

  • Use the MjCyc pathway-genome database to identify potential metabolic pathways where MJ1354 might function

  • Look for structural homology with known enzymes, even with low sequence identity (particularly important for archaeal proteins)

High-Throughput Activity Screening

  • Design a substrate matrix experiment testing the protein against diverse potential substrates

  • Consider thermostable substrates given the thermophilic nature of M. jannaschii

  • Include cofactor variations (metal ions, coenzymes) in your experimental design

  • Measure multiple potential outputs (e.g., spectrophotometric changes, product formation, cofactor consumption)

Targeted Activity Assays

  • Based on initial screening, design specific activity assays with appropriate controls

  • For thermophilic proteins like MJ1354, include temperature gradient experiments (30-85°C)

  • Control for spontaneous substrate conversion at high temperatures

  • Consider potential archaeal-specific cofactors that might be required

Validation Through Genetic Approaches

  • Design genetic complementation experiments using related archaeal species

  • Consider gene knockout studies if feasible in related model archaea

  • Heterologous expression in model organisms with phenotypic screening

The absence of characterized orthologs makes this challenging, but recent reannotation efforts in M. jannaschii provide valuable context. For example, while investigating the MJ0879 gene product, researchers initially identified it as a general-purpose nitrogenase iron protein but later determined it functions as a subunit of Ni-sirohydrochlorin a,c-diamide reductive cyclase (EC 6.3.3.7) . This highlights the importance of considering archaeal-specific biochemical pathways when investigating MJ1354.

What statistical approaches are most appropriate for analyzing experimental data involving uncharacterized proteins?

When analyzing experimental data for uncharacterized proteins like MJ1354, selecting appropriate statistical methods is critical for robust interpretation:

Experimental Design Considerations

  • For between-subjects designs (different treatment conditions applied to different protein samples), use ANOVA or ANCOVA when assumptions are met

  • For within-subjects designs (same protein samples tested under multiple conditions), consider repeated measures ANOVA

  • When comparison groups are not randomly assigned, implement quasi-experimental statistical approaches

Dealing with Non-Normal Distributions

  • Protein activity data often violates normality assumptions

  • Consider non-parametric alternatives such as:

    • Wilcoxon tests for paired or unpaired comparisons

    • Kruskal-Wallis test for multiple group comparisons

    • Permutation and bootstrap tests for increased statistical power

Advanced Statistical Techniques

  • For complex experimental designs with multiple factors:

    • Mixed-effects models to account for both fixed and random effects

    • MANOVA when measuring multiple dependent variables

  • For datasets with potential outliers, robust statistical methods are preferred

Multiple Testing Correction

  • When screening the protein against multiple conditions/substrates, apply appropriate corrections:

    • Bonferroni correction (conservative)

    • False Discovery Rate (FDR) methods (more powerful)

  • Report both uncorrected and corrected p-values for transparency

Effect Size Reporting

  • Always report effect sizes alongside p-values

  • For uncharacterized proteins, small effect sizes may still be biologically meaningful

  • Consider standardized effect sizes (Cohen's d, η²) for comparability across experiments

The goal of statistical analysis should be to distinguish true signals from noise while remaining sensitive to potentially subtle effects that might indicate biological function. For thermophilic proteins like MJ1354, conventional enzymatic activities might present differently compared to mesophilic counterparts, requiring careful consideration of statistical thresholds and biological significance .

What are the optimal conditions for expressing and purifying recombinant MJ1354?

Based on available data for recombinant MJ1354 and similar archaeal proteins, the following expression and purification protocol is recommended:

Expression Systems:

  • E. coli BL21(DE3): Most commonly used for MJ1354 expression

  • Alternative systems: Consider baculovirus expression for challenging constructs (similar to approaches used for MJ1360)

Expression Optimization:

  • Temperature: Lower induction temperature (16-20°C) despite thermophilic origin

  • Induction: 0.1-0.5 mM IPTG for E. coli systems

  • Media supplements: Consider adding rare codons tRNA supplementation for archaeal genes

  • Solubility enhancers: Fusion tags (MBP, SUMO) if His-tag alone results in poor solubility

Purification Strategy:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tag

  • Secondary purification: Size exclusion chromatography

  • Buffer optimization: Include stabilizing agents:

    • 5-10% glycerol

    • 1-5 mM DTT or 2-mercaptoethanol

    • Consider archaeal-compatible osmolytes (e.g., trehalose)

Quality Control Checkpoints:

  • SDS-PAGE analysis after each purification step

  • Western blot confirmation using anti-His antibodies

  • Mass spectrometry verification of intact mass

  • Dynamic light scattering to assess aggregation state

Storage Considerations:

  • Flash-freeze in liquid nitrogen and store at -80°C

  • Avoid repeated freeze-thaw cycles

  • Consider stability testing at different temperatures given the thermophilic origin

While specific expression yields for MJ1354 are not publicly documented, related M. jannaschii uncharacterized proteins are typically obtained at 1-5 mg/L culture in E. coli systems with optimization . The thermostable nature of proteins from this hyperthermophile can actually be advantageous during purification, as heat treatment (65-75°C for 15-30 minutes) can be used as an initial purification step to remove E. coli host proteins.

How should I design controls for functional experiments with MJ1354?

Designing appropriate controls is critical when working with uncharacterized proteins like MJ1354. A comprehensive control strategy should include:

Negative Controls

  • Buffer-only controls: Essential for establishing baseline readings in all assays

  • Heat-denatured MJ1354: To distinguish between enzymatic and non-specific chemical effects

  • Unrelated protein controls: Proteins of similar size/properties but different function

  • E. coli extract from non-transformed cells: To control for host protein contamination

Positive Controls

  • Known enzymes with established activities: When testing potential enzymatic functions

  • Related characterized proteins: If homologous proteins with known functions exist

  • Chemical standards: For calibration of analytical methods

Procedural Controls

  • Parallel processing control: Sample without key reagents processed identically

  • Time-zero measurements: Especially important for thermophilic enzyme reactions

  • Technical replicates: To assess method variability

  • Biological replicates: Independent protein preparations to control for batch effects

Validation Controls

  • Dose-response relationships: Testing across protein concentration ranges

  • Inhibitor studies: Once activity is identified, specific inhibitors can confirm mechanism

  • Site-directed mutagenesis: Modifying predicted active sites to confirm function

Context-Specific Controls for Archaeal Proteins

  • Temperature gradient controls: Test activity across temperature ranges (30-85°C)

  • pH profile controls: Establish optimal pH conditions

  • Metal-dependency controls: Include EDTA and selective chelators to identify cofactor requirements

When designing experiments, document all control conditions in a control matrix that specifies which variables are being controlled for in each experiment. This systematic approach helps separate true functional signals from artifacts when working with proteins of unknown function .

What bioinformatic approaches can predict potential functions for MJ1354?

A systematic bioinformatic analysis workflow for predicting MJ1354 function should utilize multiple complementary approaches:

Sequence-Based Methods

  • Homology searches: BLASTp, PSI-BLAST, and HHpred against comprehensive databases

  • Motif identification: PROSITE, InterPro, and PFAM for functional domain prediction

  • Remote homology detection: Profile-profile alignments for distant relationships

  • Conservation analysis: ConSurf for identifying functionally important residues

Structure-Based Methods

  • Secondary structure prediction: PSIPRED, JPred4

  • Tertiary structure prediction: AlphaFold2, RoseTTAFold

  • Structural classification: CATH, SCOP for fold recognition

  • Binding site prediction: CASTp, SiteMap, FTMap

  • Active site identification: Catalytic Site Atlas comparisons

Genomic Context Analysis

  • Gene neighborhood analysis: Examine consistently co-located genes in archaeal genomes

  • Gene fusion analysis: Search for fusion events with proteins of known function

  • Phylogenetic profiling: Identify co-occurrence patterns across species

  • Pathway integration: Use MjCyc database to identify potential metabolic roles

Integration with Experimental Data

  • Proteomics data mining: Search for MJ1354 in archaeal proteomics datasets

  • Metabolomics correlation: Connect to metabolomic profiling of M. jannaschii

  • Expression pattern analysis: Examine under what conditions MJ1354 is expressed

Case Example of Bioinformatic Success:
Recent reannotation efforts for M. jannaschii demonstrate the power of integrated bioinformatic approaches. For example, researchers successfully identified MJ0879 as a subunit of Ni-sirohydrochlorin a,c-diamide reductive cyclase (EC 6.3.3.7) despite previous misannotation as a general-purpose nitrogenase iron protein . Similarly, MJ0570 was reassigned as diphthamide synthase (EC 6.3.1.14) based on sequence analysis and metabolic reconstruction .

When applying these approaches to MJ1354, focus on archaeal-specific pathways, particularly those involved in methanogenesis or adaptations to extreme environments, as these represent areas where novel protein functions are most likely to be discovered .

How can I integrate MJ1354 into the broader metabolic context of Methanocaldococcus jannaschii?

Integrating an uncharacterized protein like MJ1354 into the metabolic framework of M. jannaschii requires a multi-faceted approach:

Pathway-Genome Database Analysis

  • Utilize the MjCyc database, which contains 883 reactions, 540 enzymes, and 142 individual pathways

  • Identify "pathway holes"—reactions predicted to exist but lacking gene assignments

  • Analyze MJ1354's genomic context in relation to known metabolic operons

  • The recent reannotation efforts have still left approximately one-third of the genome functionally uncharacterized, creating opportunities for novel pathway discoveries

Comparative Metabolic Analysis

  • Compare metabolic capabilities across different methanogenic archaea

  • Identify pathways unique to M. jannaschii where MJ1354 might participate

  • Examine species with similar proteins to determine if they share metabolic capabilities

Experimental Integration Approaches

  • Metabolic fingerprinting: Compare metabolite profiles between wild-type and MJ1354-altered samples

  • Flux analysis: Use stable isotope labeling to track metabolic fluxes

  • Protein-protein interaction studies: Identify interaction partners within known pathways

  • Transcriptional co-regulation: Identify genes co-regulated with MJ1354 under various conditions

Predictive Metabolic Modeling

  • Develop in silico metabolic models incorporating hypothetical functions for MJ1354

  • Test model predictions against experimental observations

  • Iteratively refine models as new data becomes available

When approaching this integration, consider that M. jannaschii possesses several unique metabolic features as a hyperthermophilic methanogen. It grows exclusively on carbon dioxide and hydrogen as primary energy sources (unlike other methanococci that can use formate) . The organism contains numerous hydrogenases and unique cofactors involved in the methanogenesis pathway , which may provide contextual clues for MJ1354's function.

Recent pathway discoveries in M. jannaschii include novel amino acid synthesis pathways, methanogenic cofactor synthesis routes, and archaeal-specific information processing pathways , suggesting potential areas where MJ1354 might function.

What approaches can resolve contradictory experimental results when studying MJ1354?

When facing contradictory experimental results with an uncharacterized protein like MJ1354, employ the following systematic resolution strategy:

Critical Data Assessment

  • Review raw data for all experiments showing contradictory results

  • Evaluate experimental conditions for subtle differences:

    • Buffer composition variations

    • Protein batch differences

    • Temperature fluctuations (especially critical for thermophilic proteins)

    • Presence of trace contaminants

  • Classify contradictions as either qualitative (presence/absence of activity) or quantitative (differences in degree)

Methodological Reconciliation

  • Reproduce key experiments using standardized protocols

  • Cross-validate using orthogonal techniques

  • Blind testing to eliminate observer bias

  • Interlaboratory validation if resources permit

Statistical Reanalysis

  • Apply appropriate statistical tests based on experimental design

  • Consider statistical power - was the sample size sufficient?

  • Evaluate effect sizes rather than just p-values

  • Use meta-analysis techniques to integrate multiple experimental results

Investigate Biological Explanations for Contradictions

  • Protein heterogeneity: Check for multiple conformational states

  • Post-translational modifications: Assess if modifications affect activity

  • Cofactor dependencies: Test with and without various potential cofactors

  • Oligomerization states: Determine if protein concentration affects functional properties

Context-Specific Considerations for Archaeal Proteins

  • Temperature-dependent functional switches

  • Adaptive conformational changes under different conditions

  • Moonlighting functions (multiple distinct activities in different contexts)

What novel experimental techniques show promise for characterizing proteins like MJ1354?

Several cutting-edge techniques show particular promise for elucidating the function of archaeal uncharacterized proteins like MJ1354:

Advanced Structural Biology Approaches

  • Cryo-EM for Protein Complexes: Enables visualization of MJ1354 in native-like complexes without crystallization

  • Time-Resolved Crystallography: Captures conformational changes during potential catalytic events

  • Integrative Structural Biology: Combines multiple structural data sources (X-ray, NMR, SAXS, crosslinking-MS)

  • AlphaFold2-Guided Structural Analysis: Uses AI-predicted structures to guide experimental design

High-Resolution Functional Genomics

  • CRISPR Interference in Archaeal Systems: Targeted gene repression to study loss-of-function phenotypes

  • Ribosome Profiling: Maps translation dynamics and potential regulatory mechanisms

  • Proximity Labeling Proteomics: BioID or APEX2 fusions to identify interaction neighborhoods

  • Thermal Proteome Profiling: Measures thermal stability changes upon ligand binding

Single-Molecule Techniques

  • Single-Molecule FRET: Detects conformational dynamics under various conditions

  • Optical Tweezers: Measures force generation in potential motor proteins

  • Nanopore Analysis: Detects substrate interactions and conformational changes

Advanced Metabolomic Approaches

  • Activity-Based Protein Profiling: Uses chemical probes to detect and identify enzyme activities

  • Enzyme Activity Metabolomics: Systematic screening against metabolite libraries

  • Isotope Tracing with High-Resolution MS: Tracks substrate conversion with stable isotopes

Artificial Intelligence Integration

  • Machine Learning for Activity Prediction: Trained on known enzymes to predict MJ1354 function

  • Network Analysis Algorithms: Integrates multiple data types to predict protein function

  • Adaptive Experimental Design: AI-guided selection of optimal experimental conditions

Native Environment Approaches

  • In situ Cryo-Electron Tomography: Visualizes proteins in their cellular context

  • High-Temperature Activity Assays: Tests function under native-like conditions (65-85°C)

  • Reconstituted Membrane Systems: Assesses potential membrane-associated functions

When applying these techniques to MJ1354, it's essential to consider the thermophilic nature of M. jannaschii and adapt protocols accordingly. For instance, in vitro translation systems may need to be modified to function at elevated temperatures, and stabilizing agents may be required to maintain protein integrity during analysis.

Recent successes with other uncharacterized proteins from M. jannaschii demonstrate the value of integrating multiple approaches. For example, the reannotation of MJ0570 as diphthamide synthase (EC 6.3.1.14) combined sequence analysis with pathway reconstruction to complete the previously incomplete diphthamide biosynthesis pathway .

How should I organize and report experimental findings on an uncharacterized protein like MJ1354?

When publishing research on an uncharacterized protein like MJ1354, follow these best practices for comprehensive reporting:

Manuscript Structure and Content

  • Introduction: Place MJ1354 in the broader context of archaeal biology and M. jannaschii metabolism

  • Methods: Provide detailed protocols sufficient for reproduction, including:

    • Expression and purification procedures with buffer compositions

    • Detailed experimental conditions (temperature, pH, time points)

    • Statistical analysis approaches with justification

  • Results: Present findings in a logical progression from basic characterization to functional insights

  • Discussion: Interpret results in the context of archaeal biochemistry and potential metabolic roles

Data Presentation Standards

  • Include complete datasets rather than representative examples

  • Present negative results alongside positive findings

  • Use appropriate statistical visualizations (box plots rather than bar graphs for distributions)

  • Include sufficient replicates (both technical and biological)

Supplementary Materials

  • Provide raw data in machine-readable formats

  • Include detailed MS/MS spectra if proteomic approaches were used

  • Share sequence verification data and construct maps

  • Document all tested conditions, including unsuccessful trials

Data Deposition Requirements

  • Deposit sequences in GenBank or similar repositories

  • Submit structural data to PDB or EMDB as appropriate

  • Share proteomics data via ProteomeXchange

  • Consider developing a project website for complex datasets

Nomenclature and Annotation Considerations

  • Clearly state the evidence supporting any functional assignments

  • Use evidence codes (experimental, computational prediction, etc.)

  • If proposing a new function, follow community guidelines for enzyme classification

  • Consider initiating updates to genome annotation databases with new findings

Example Table Format for Activity Screening:

Potential SubstrateActivity (nmol/min/mg)Temperature Optimum (°C)pH OptimumCofactor RequirementStatistical Significance
Substrate A0.52 ± 0.08756.5Mg2+p < 0.001
Substrate BNot detectedN/AN/AN/AN/A
Substrate C0.04 ± 0.01657.2Nonep = 0.047

Following these guidelines ensures that your research on MJ1354 will be maximally useful to the scientific community and facilitate further studies on this and related uncharacterized proteins.

What are the most promising research directions for further characterizing MJ1354 and similar uncharacterized archaeal proteins?

Based on current knowledge and technologies, several promising research directions for MJ1354 characterization include:

Integrative Multi-Omics Approaches

  • Combine transcriptomics, proteomics, and metabolomics data from M. jannaschii under various conditions

  • Correlate MJ1354 expression patterns with specific metabolic states

  • Identify co-expressed gene clusters that might indicate functional relationships

  • Apply network analysis to place MJ1354 in the broader cellular context

Evolutionary and Comparative Genomics

  • Perform comprehensive phylogenetic analysis across archaeal lineages

  • Identify conserved residues as potential functional sites through evolutionary analysis

  • Study gene neighborhood conservation patterns across methanogens

  • Investigate potential horizontal gene transfer events that might provide functional clues

Genetic System Development

  • Develop or improve genetic manipulation systems for M. jannaschii or related model methanogens

  • Create knockout or knockdown strains to observe phenotypic consequences

  • Implement complementation studies in related archaea with genetic tools

  • Develop reporter systems functional in thermophilic conditions

Biochemical Characterization

  • Perform systematic substrate screening using metabolite libraries

  • Investigate potential protein-protein interactions using thermostable protein complementation assays

  • Study post-translational modifications specific to archaeal systems

  • Examine potential roles in archaeal-specific metabolic pathways

Structural Biology Integration

  • Determine high-resolution structures through X-ray crystallography or cryo-EM

  • Perform ligand-binding studies using thermal shift assays adapted for thermophiles

  • Use structure-guided mutagenesis to test functional hypotheses

  • Apply molecular dynamics simulations under high-temperature conditions

Applied Research Directions

  • Investigate potential biotechnological applications of thermostable proteins

  • Explore MJ1354's possible role in extremozyme development

  • Study potential involvement in methanogenesis for bioenergy applications

  • Examine thermoadaptation mechanisms with implications for protein engineering

The MjCyc pathway-genome database project demonstrates the value of revisiting annotation efforts for model organisms like M. jannaschii. Despite being the first archaeal genome sequenced in 1996, new functional insights continue to emerge through improved computational approaches and experimental validation . For MJ1354 specifically, the lack of assigned enzyme roles for approximately two-thirds of the protein-coding entries in M. jannaschii suggests ample opportunity for novel functional discoveries.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.