Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1365 (MJ1365)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for the specific delivery time.
Note: All protein shipments are accompanied by standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
MJ1365; Uncharacterized protein MJ1365
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-397
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1365
Target Protein Sequence
MVIILRHVRVFNGVNECDIYLIGTAHVSKDSIEEVEKIISSVSPEGIAVELDDRRFFSLI TNEEKKVDLKKVLKEGNFLKFFIYLILANSQKKIGESFGIKPGSEMKKAIEIASKYGLPI YLIDRDIDITLSRLMDRMTFKEKMKIFWELLNSDEEDLELDDDLLNDMVKNPEKFIKLLK EISPTIYEVLVDERDRFMAKRLFELSKNKNSLVAVVGAGHVEGIVRYLKKLENGNDIDLM ELIKVKKRKKSLKKLLTYGISLTIISIFLYMICYALNNPELLKMITFQWILFTGGLSALG VLLARGKLITALVAFLSAPITTLVPLPLAAVGTIAGLVELKYREITDKDLVGIINAESIK ELLNNNLFRVLLVATLSNLGASIGVFYCLGKFIGFLG
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1365

STRING: 243232.MJ_1365

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the genomic context of MJ1365 in Methanocaldococcus jannaschii?

MJ1365 is encoded within the 1.66-megabase circular chromosome of Methanocaldococcus jannaschii. The complete genome sequence of M. jannaschii consists of three physically distinct elements: a large circular chromosome and two extrachromosomal elements (ECEs)—one large and one small circular ECE . The specific genomic context of MJ1365, including neighboring genes and potential operons, can provide clues about its possible function through guilt-by-association approaches. Researchers should examine the intergenic segments flanking the MJ1365 open reading frame (ORF), as these regions may contain regulatory elements that influence expression patterns .

What are the basic structural properties of the MJ1365 protein?

The recombinant full-length MJ1365 protein consists of 397 amino acids . While detailed structural information is limited in the available literature, researchers can apply bioinformatic approaches to predict secondary structure elements, domains, and potential functional motifs. Computational analysis using structure prediction algorithms can generate hypotheses about protein folding patterns typical of archaeal proteins, particularly those adapted to extreme environments. For experimental validation, researchers should consider circular dichroism spectroscopy to determine secondary structure content and thermal stability assessments to evaluate the thermostability expected of proteins from this hyperthermophilic organism.

How can I express and purify recombinant MJ1365 protein for laboratory studies?

The recombinant MJ1365 protein has been successfully expressed in E. coli as a His-tagged construct . A methodological approach for expression and purification would include:

  • Cloning the MJ1365 open reading frame into an appropriate expression vector containing a histidine tag

  • Transforming the construct into a suitable E. coli strain optimized for archaeal protein expression

  • Inducing protein expression under controlled conditions (temperature, IPTG concentration, duration)

  • Lysing cells and purifying the His-tagged protein using nickel affinity chromatography

  • Performing additional purification steps (size exclusion, ion exchange) as needed

It's important to note that archaeal proteins often require optimization of expression conditions due to codon usage differences and potential toxicity to bacterial hosts. Consider using specialized E. coli strains with additional tRNAs for rare codons and testing expression at lower temperatures (15-25°C) to improve proper folding .

What methods can determine potential binding partners of MJ1365?

To identify potential binding partners of MJ1365, researchers can employ multiple complementary approaches:

  • Affinity Capture Techniques: Using purified His-tagged MJ1365 as bait, perform pull-down assays with M. jannaschii cell lysates followed by mass spectrometry analysis of co-precipitated proteins .

  • Yeast Two-Hybrid Screening: While challenging due to the archaeal origin of MJ1365, modified Y2H systems adapted for archaeal proteins can identify potential protein-protein interactions .

  • Crosslinking Mass Spectrometry: Chemical crosslinking of MJ1365 with potential interaction partners followed by mass spectrometry can identify proximity-based interactions.

  • Computational Prediction: Employ protein-protein interaction prediction algorithms based on structural features and sequence conservation patterns across archaeal species.

For validation of identified interactions, researchers should consider multiple orthogonal techniques, as single-method approaches may yield false positives. Surface plasmon resonance or isothermal titration calorimetry can provide quantitative binding parameters for confirmed interactions.

How can I design experiments to determine the cellular localization of MJ1365 in M. jannaschii?

Determining the cellular localization of MJ1365 requires specialized approaches for archaeal systems:

  • Immunolocalization: Generate specific antibodies against purified MJ1365 and perform immunofluorescence microscopy on fixed M. jannaschii cells.

  • Subcellular Fractionation: Fractionate M. jannaschii cells into membrane, cytosolic, and nucleoid fractions, followed by Western blot analysis with anti-MJ1365 antibodies.

  • Reporter Fusion Systems: Create fusion constructs of MJ1365 with archaeal-specific fluorescent tags that can function under high-temperature conditions.

When interpreting localization data, consider the unique cellular architecture of archaea, which combines features of both bacteria and eukaryotes. The absence of organelles in archaeal cells means that localization patterns may differ from those observed in eukaryotic systems .

What computational approaches can predict potential functions of MJ1365?

In the absence of experimental characterization, computational methods offer valuable insights into potential MJ1365 functions:

  • Homology Modeling: Identify distant homologs with known functions through sensitive sequence comparison methods like PSI-BLAST or HHpred.

  • Structural Prediction: Use AlphaFold or similar algorithms to predict the three-dimensional structure, then compare with structurally characterized proteins regardless of sequence similarity.

  • Genomic Context Analysis: Examine the operonic structure and nearby genes in the M. jannaschii genome to identify functional associations.

  • Phylogenetic Profiling: Analyze the pattern of presence/absence of MJ1365 homologs across archaeal species to identify proteins with similar evolutionary distributions.

Integration of multiple computational approaches typically provides more reliable predictions than any single method. Results should be interpreted with caution and used to generate testable hypotheses for experimental validation .

How can I design assays to test potential enzymatic activities of MJ1365?

When characterizing an uncharacterized protein like MJ1365, a systematic approach to testing enzymatic activities includes:

  • Sequence-Based Prediction: Analyze the protein sequence for conserved motifs associated with known enzyme classes using tools like InterPro, Pfam, and PROSITE.

  • Structure-Based Prediction: Once a predicted or experimental structure is available, analyze potential active site pockets for similarity to known enzyme active sites.

  • High-Throughput Activity Screening: Test purified MJ1365 against panels of potential substrates representing major enzyme classes (hydrolases, transferases, oxidoreductases, etc.).

  • Activity-Based Protein Profiling: Use chemical probes designed to react with specific enzyme classes to identify potential activities.

Given the archaeal origin and hyperthermophilic nature of M. jannaschii, enzyme assays should be conducted at elevated temperatures (85°C is optimal for most M. jannaschii proteins) and under anaerobic conditions when appropriate .

What approaches can be used to study the temperature stability and activity profile of MJ1365?

As a protein from a hyperthermophilic archaeon, MJ1365 likely possesses remarkable thermostability. To characterize its temperature-dependent properties:

  • Differential Scanning Calorimetry: Measure the melting temperature (Tm) and thermodynamic parameters of unfolding.

  • Thermal Activity Profiling: If enzymatic activity is identified, measure activity across a temperature range (20-100°C) to determine temperature optima.

  • Circular Dichroism with Temperature Ramping: Monitor secondary structure changes during heating and cooling cycles to assess thermal stability and refolding capacity.

  • Limited Proteolysis at Various Temperatures: Compare resistance to proteolytic degradation at different temperatures to identify thermally labile regions.

Results from these analyses can provide insights into the structural adaptations that enable proteins from hyperthermophiles to function at extreme temperatures, potentially informing protein engineering applications for thermostable enzymes .

How can I identify potential homologs of MJ1365 in other archaeal and bacterial species?

To identify potential homologs of MJ1365 across diverse species:

  • Sequence-Based Homology Searches: Perform BLAST, PSI-BLAST, and HMMER searches against comprehensive protein databases, adjusting parameters to detect remote homologs.

  • Profile-Based Methods: Create sequence profiles or hidden Markov models (HMMs) from aligned MJ1365 homologs to enhance detection of distant relationships.

  • Structure-Based Homology Detection: If structural data becomes available, use structural alignment tools like DALI or FATCAT to identify proteins with similar folds despite low sequence identity.

  • Genomic Context Conservation: Examine conservation of gene neighborhoods around MJ1365 homologs to identify functionally linked gene clusters.

When analyzing results, distinguish orthologs (related by speciation) from paralogs (related by duplication), as this distinction has important functional implications. The conservation pattern of MJ1365 across archaeal lineages may provide insights into its evolutionary age and functional importance .

What can comparative genomics reveal about the conservation and evolution of MJ1365?

Comparative genomic analysis of MJ1365 can reveal important evolutionary insights:

  • Phylogenetic Distribution: Map the presence/absence of MJ1365 homologs across the archaeal phylogenetic tree to determine evolutionary conservation.

  • Selective Pressure Analysis: Calculate dN/dS ratios across homologs to identify regions under purifying or positive selection.

  • Domain Architecture Comparison: Examine whether MJ1365 homologs in different species share similar domain organizations or have acquired/lost domains.

  • Horizontal Gene Transfer Assessment: Analyze phylogenetic incongruencies and nucleotide composition biases to detect potential horizontal gene transfer events.

This evolutionary context is crucial for understanding the functional constraints on MJ1365 and may help distinguish essential functions (highly conserved) from species-specific adaptations .

How can CRISPR-based approaches be adapted for studying MJ1365 function in M. jannaschii?

Applying CRISPR technologies to archaeal systems requires specific adaptations:

  • Archaeal CRISPR-Cas Systems: Utilize native CRISPR-Cas systems from M. jannaschii or related archaea that function at high temperatures.

  • Vector Development: Design temperature-stable expression vectors that can maintain integrity in hyperthermophilic conditions.

  • Transformation Protocols: Optimize transformation methods specific to M. jannaschii, considering its cell wall structure and growth conditions.

  • Phenotypic Assays: Develop assays to detect changes in growth, metabolism, or stress responses following MJ1365 modification.

While technically challenging, CRISPR-based approaches offer powerful ways to create knockouts, knockdowns, or tagged versions of MJ1365 for functional studies in its native context. Alternative approaches using heterologous expression in more tractable archaeal hosts like Thermococcus kodakarensis may provide a compromise between native relevance and experimental tractability .

What structural biology techniques are most appropriate for determining the three-dimensional structure of MJ1365?

For structural determination of MJ1365, several complementary approaches can be employed:

  • X-ray Crystallography:

    • Requires production of diffraction-quality crystals of purified MJ1365

    • May benefit from thermostability of archaeal proteins, which often enhances crystallizability

    • Consider using His-tag constructs already described for initial crystallization trials

  • Cryo-Electron Microscopy:

    • Particularly valuable if MJ1365 forms complexes with other proteins

    • Avoids crystallization bottleneck but may require larger quantities of pure protein

  • Nuclear Magnetic Resonance (NMR):

    • Suitable if MJ1365 can be isotopically labeled (15N, 13C) during recombinant expression

    • Provides dynamic information in addition to structure

    • May be limited by the relatively large size of full-length MJ1365 (397 amino acids)

  • Integrative Structural Biology:

    • Combine lower-resolution experimental data (SAXS, crosslinking-MS) with computational modeling

    • Particularly valuable for difficult-to-crystallize proteins or multi-domain arrangements

Each method has specific advantages, and the choice should depend on the specific research questions and available resources. For initial characterization, computational structure prediction using AlphaFold2 may provide valuable structural hypotheses to guide experimental approaches .

Data Table: Expression and Purification Parameters for Recombinant MJ1365

ParameterRecommended ConditionAlternative ConditionNotes
Expression HostE. coli BL21(DE3)E. coli Rosetta(DE3)Rosetta strain provides additional tRNAs for rare codons
Expression VectorpET-28a (N-terminal His-tag)pET-SUMOSUMO fusion may enhance solubility
Induction Temperature18°C25°CLower temperatures often improve folding of archaeal proteins
IPTG Concentration0.2 mM0.5 mMLower concentrations reduce inclusion body formation
Induction Duration16-18 hours4-6 hoursLonger times at lower temperatures often increase yield
Lysis Buffer50 mM Tris pH 8.0, 500 mM NaCl, 10% glycerol50 mM HEPES pH 7.5, 300 mM NaClInclude protease inhibitors in both conditions
Purification MethodNi-NTA affinity chromatographyTALON cobalt resinNi-NTA may provide higher capacity
Secondary PurificationSize exclusion chromatographyIon exchange chromatographySize exclusion provides information on oligomeric state
Storage Buffer20 mM Tris pH 7.5, 150 mM NaCl, 10% glycerol50 mM phosphate pH 7.0, 100 mM NaClTest thermostability in different buffers

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.