Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1395 (MJ1395)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1395 (MJ1395) is a protein derived from the archaeon Methanocaldococcus jannaschii. M. jannaschii is a hyperthermophilic methanogen, meaning it thrives in high-temperature environments and produces methane as a metabolic byproduct . MJ1395 is referred to as an uncharacterized protein because its specific function within the organism is not yet fully understood .

Basic Information

FeatureDescription
Full NameRecombinant Full Length Methanocaldococcus jannaschii Uncharacterized Protein MJ1395(MJ1395) Protein, His-Tagged
SourceE. coli
SpeciesMethanocaldococcus jannaschii
TagHis-Tag
Protein LengthFull Length (1-132 amino acids)
SynonymsMJ1395; Uncharacterized protein MJ1395
UniProt IDQ58790
Amino Acid SequenceMDVNVSYKDTYSVITYQVWEPIDGGKNITLIIEYDADIVDNGILFKTVSIPIGGDLNIKNFHINFVSPYYLTYQEPDGNNFQIPKKTLLIINAEFSILPLPKLPVHGYVVFWLSILCILIIIFVYTELRRKK

Production and Characteristics

Recombinant MJ1395 is produced in E. coli and tagged with histidine (His-Tag) . The protein is purified and available as a lyophilized powder . It is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the option to add glycerol for long-term storage at -20°C/-80°C .

  • Purity: Greater than 90% as determined by SDS-PAGE

  • Form: Lyophilized powder

  • Storage: Store at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles

  • Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Function and Interactions

As an uncharacterized protein, the precise biochemical function of MJ1395 remains unknown . Computational analyses suggest its potential involvement in various pathways and interactions with other proteins, but experimental validation is needed .

Methanocaldococcus jannaschii

Methanocaldococcus jannaschii is a key organism in the study of archaeal metabolism and adaptation to extreme environments . It was the first archaeal genome to be sequenced, which provided insights into methanogenesis and unique metabolic pathways . Genetic tools have been developed to study M. jannaschii, facilitating the purification of proteins and enabling physiological studies .

Related Research

  • Ataxin-3 Interaction: Research indicates that Ataxin-3, a protein associated with Machado-Joseph disease, interacts with human homologs of the yeast DNA repair protein RAD23 . This interaction may provide insights into the normal function of Ataxin-3 and potential functional abnormalities in Machado-Joseph disease .

  • Proteasome-Activating Nucleotidase (PAN): A homolog from Methanococcus jannaschii (MJ1176) has been purified from recombinant Escherichia coli and named PAN, which exhibits ATPase activity and activates energy-dependent degradation of proteins .

  • MjCyc Database: The MjCyc pathway-genome database is a resource for M. jannaschii research, providing updated function assignments and metabolic reconstructions. It includes information on enzymatic reactions, enzymes/transporters, and individual pathways .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion in the manufacturing process.
Synonyms
MJ1395; Uncharacterized protein MJ1395
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1395
Target Protein Sequence
MDVNVSYKDTYSVITYQVWEPIDGGKNITLIIEYDADIVDNGILFKTVSIPIGGDLNIKN FHINFVSPYYLTYQEPDGNNFQIPKKTLLIINAEFSILPLPKLPVHGYVVFWLSILCILI IIFVYTELRRKK
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1395

STRING: 243232.MJ_1395

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant in research?

Methanocaldococcus jannaschii is a hyperthermophilic methanogen that was first isolated from deep-sea hydrothermal vents where environmental conditions resemble those of early Earth. This archaeon holds exceptional scientific significance as it was the first hyperthermophilic chemolithotrophic organism isolated from such environments. M. jannaschii derives energy exclusively through hydrogenotrophic methanogenesis (4H₂ + CO₂ → CH₄ + 2H₂O), one of the most ancient respiratory metabolisms on Earth, believed to have developed approximately 3.49 billion years ago . The organism's ability to generate its entire cellular biomass from inorganic nutrients represents a minimal requirement for life to exist independently of other living systems .

How can researchers determine if MJ1395 is essential for M. jannaschii survival?

Determining the essentiality of MJ1395 requires a systematic approach combining genetic manipulation and physiological assessment. Researchers should implement the following methodology:

  • Gene knockout studies: Utilize the recently developed genetic system for M. jannaschii to create a knockout strain through homologous recombination. This typically involves constructing a suicide plasmid containing upstream and downstream regions of the target gene flanking a selectable marker (such as mevinolin resistance) .

  • Growth comparison analysis: Compare growth rates and metabolic activities (particularly methanogenesis) between wild-type and knockout strains under various conditions, including different temperatures, pressures, and nutrient availabilities that mimic the organism's natural deep-sea hydrothermal vent environment.

  • Complementation tests: Reintroduce the MJ1395 gene through a complementation vector to verify if observed phenotypic changes are directly attributable to the absence of MJ1395.

  • Transcriptomic profiling: Analyze gene expression changes in the knockout strain to identify compensatory mechanisms that might mask the protein's essentiality under laboratory conditions.

Researchers should note that genetic manipulation of M. jannaschii is challenging due to its extremophilic nature, but successful transformation protocols using linearized plasmids for homologous recombination have been reported, as exemplified by the development of strain M. jannaschii BM31 .

What structural features might indicate potential functions of MJ1395?

Analysis of MJ1395's structural features requires a multi-faceted approach to generate functional hypotheses:

  • Sequence-based structure prediction: Current protein structure prediction algorithms (AlphaFold2, RoseTTAFold) can generate structural models of MJ1395 with reasonable confidence. These models should be analyzed for:

    • Secondary structure elements characteristic of known functional domains

    • Potential binding pockets or catalytic sites

    • Surface charge distribution patterns indicative of protein-protein or protein-nucleic acid interactions

  • Motif analysis: The sequence contains hydrophobic stretches in the C-terminal region (VVFWLSILCILIIIIFVYTELRRKK) suggesting potential membrane association, along with a positively charged terminal region (RRKK) that might function in protein-membrane interactions or protein localization .

  • Comparative structural analysis: Structural alignment with proteins of known function, even with low sequence similarity, may reveal structural conservation suggesting functional parallels.

  • Thermal adaptation features: Analysis of amino acid composition for features associated with thermostability (increased proportion of charged residues, fewer thermolabile residues, tighter hydrophobic packing) might suggest adaptations specific to the hyperthermophilic lifestyle of M. jannaschii.

The interpretation of these features should be contextualized within M. jannaschii's unique physiology and evolutionary position to generate testable hypotheses about MJ1395's function.

What experimental approaches are most effective for characterizing MJ1395's biochemical function?

A comprehensive functional characterization of MJ1395 requires a strategic combination of biochemical, biophysical, and genetic approaches:

  • Protein-protein interaction studies:

    • Pull-down assays using recombinant tagged MJ1395 as bait

    • Crosslinking followed by mass spectrometry to identify interaction partners

    • Yeast two-hybrid screening adapted for archaeal proteins

  • Subcellular localization:

    • Immunoelectron microscopy using antibodies against MJ1395

    • Fractionation studies combined with Western blotting

    • Fluorescent protein tagging in genetically modified M. jannaschii strains

  • Functional screening:

    • Activity assays based on bioinformatic predictions

    • Heterologous expression in model organisms with phenotypic screening

    • Metabolomic analysis of knockout strains

  • High-throughput approaches:

    • Microarray or RNA-seq analysis of gene expression changes in response to MJ1395 manipulation

    • Chemical genetics to identify small molecules that interact with MJ1395

For effective characterization, researchers should develop specialized assays that function at the high temperatures (85°C) optimal for M. jannaschii proteins, potentially utilizing thermostable detection reagents and specialized equipment .

How might MJ1395 contribute to M. jannaschii's adaptation to extreme environments?

Understanding MJ1395's potential role in extremophilic adaptation requires examining its properties within the context of known archaeal stress response mechanisms:

  • Thermal stability analysis:

    • Circular dichroism spectroscopy at varying temperatures to determine melting temperature and conformational changes

    • Differential scanning calorimetry to quantify thermodynamic parameters of protein unfolding

    • Activity assays at different temperatures to determine temperature optima and stability

  • Pressure adaptation studies:

    • Expression analysis under varying pressure conditions

    • Structure and activity analysis using high-pressure biophysical methods

    • Comparison with homologs from non-barophilic organisms

  • Stress response correlation:

    • Quantitative proteomics to measure MJ1395 abundance under different stress conditions

    • Transcriptional analysis of MJ1395 expression patterns during heat shock, oxidative stress, and pressure changes

    • Comparison of stress tolerance between wild-type and MJ1395 knockout strains

The membrane-associated features of MJ1395 suggested by its C-terminal hydrophobic region may indicate roles in maintaining membrane integrity under extreme conditions, potentially through interactions with archaeal-specific membrane lipids that contribute to thermostability .

What expression systems are optimal for producing functional recombinant MJ1395?

Producing properly folded recombinant proteins from hyperthermophilic archaea presents unique challenges that require specialized expression strategies:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, simplicity, cost-effectivePotential misfolding, inclusion body formationCodon optimization, fusion tags (MBP, SUMO), co-expression with archaeal chaperones, reduced induction temperature
Archaeal hosts (H. volcanii, T. kodakarensis)Native-like folding environment, post-translational modificationsLower yield, complex growth requirementsStrong archaeal promoters, optimized selectable markers, improved transformation protocols
Cell-free systemsAvoids toxicity issues, rapidExpensive, limited scaleSupplementation with archaeal ribosomes and cofactors, optimization of redox conditions
Mammalian cell linesComplex folding machineryLow yield, expensiveCodon optimization, inducible expression systems

For MJ1395 specifically, the E. coli system with the following modifications has shown success for other M. jannaschii proteins:

  • BL21(DE3) strain supplemented with rare codons

  • N-terminal 6xHis or 3xFLAG-twin Strep tag for purification

  • Expression at 18-25°C after induction to reduce inclusion body formation

  • Co-expression with archaeal chaperones (e.g., thermosome subunits)

Post-expression validation should include careful assessment of protein folding through circular dichroism or limited proteolysis to ensure the recombinant protein resembles the native state.

What purification protocols maintain the native conformation of thermostable MJ1395?

Purifying hyperthermophilic proteins requires protocols that preserve their unique structural characteristics:

  • Initial purification strategy:

    • Affinity chromatography using tags (His, Strep, FLAG) at pH 7.5-8.0 and elevated temperature (40-50°C)

    • Heat treatment (70-80°C for 15-20 minutes) of cell lysates to precipitate host proteins while preserving thermostable MJ1395

    • Addition of reducing agents (5-10 mM DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

  • Secondary purification:

    • Ion exchange chromatography based on theoretical pI of MJ1395

    • Size exclusion chromatography to separate oligomeric states

    • Hydrophobic interaction chromatography if membrane-association is suspected

  • Buffer optimization:

    • Inclusion of stabilizing agents (glycerol 10-20%, specific ions based on M. jannaschii's intracellular environment)

    • pH optimization based on stability profiling

    • Potential inclusion of archaeal-specific lipids if membrane interactions are relevant

  • Storage conditions:

    • Tris-based buffer with 50% glycerol as indicated in commercial preparations

    • Aliquoting to avoid repeated freeze-thaw cycles

    • Storage at -20°C for short-term or -80°C for extended storage

Quality control should include activity assays (once established), thermal shift assays to confirm expected thermostability, and dynamic light scattering to assess homogeneity and aggregation state.

How can researchers design effective crystallization trials for structure determination of MJ1395?

Crystallizing proteins from hyperthermophiles requires specific considerations:

  • Pre-crystallization assessment:

    • Homogeneity analysis via dynamic light scattering

    • Thermal stability testing to determine optimal buffer conditions

    • Limited proteolysis to identify stable domains if full-length protein proves recalcitrant to crystallization

    • Circular dichroism to confirm secondary structure content

  • Crystallization screening strategy:

    • Initial broad screening at both mesophilic (20°C) and thermophilic (40-60°C) temperatures

    • Specialized screens incorporating conditions successful for other archaeal proteins

    • Inclusion of potential cofactors or binding partners identified through bioinformatic analysis

    • Surface entropy reduction engineering for regions predicted to hinder crystal contact formation

  • Optimization approaches:

    • Microseeding to improve crystal quality

    • Counter-diffusion techniques for slow equilibration

    • Lipid cubic phase methods if membrane association is suspected

    • Heavy atom derivatives preparation for phasing

  • Alternative structure determination methods:

    • NMR spectroscopy for structural characterization in solution

    • Cryo-electron microscopy if MJ1395 forms larger complexes

    • Small-angle X-ray scattering for low-resolution envelope determination

Researchers should note that proteins from M. jannaschii often exhibit unique structural features related to thermostability, such as increased hydrophobic interactions, additional salt bridges, and compact packing, which may influence crystallization behavior .

What bioinformatic resources are most useful for studying MJ1395?

Researchers should utilize specialized computational tools for hyperthermophilic archaeal proteins:

  • Sequence analysis tools:

    • Archaeal-specific homology detection using PSI-BLAST with adjusted parameters

    • Hidden Markov Model profiles from archaeal protein families

    • Coevolution analysis to identify functionally linked residues

  • Structure prediction resources:

    • AlphaFold2 and RoseTTAFold with archaeal-specific templates

    • Molecular dynamics simulations at elevated temperatures to assess thermal stability

    • Modeling of post-translational modifications specific to archaea

  • Functional annotation databases:

    • Archaeal Clusters of Orthologous Genes (arCOGs)

    • Comparative analysis across the archaeal domain

    • Integration with experimental data from other uncharacterized archaeal proteins

  • Data integration platforms:

    • Archaeal genome browsers with experimental data overlays

    • Metabolic pathway databases with archaeal-specific pathways

    • Protein-protein interaction networks incorporating archaeal interactome data

These resources should be used within a framework that considers the unique evolutionary position of M. jannaschii and the specialized adaptations of its proteins to extreme environments.

How can researchers validate predicted functions of MJ1395 in vitro?

Function validation requires a systematic approach combining biochemical and genetic methods:

  • Biochemical validation pathway:

    • Substrate screening based on bioinformatic predictions

    • Activity assays under conditions mimicking the native environment (85°C, high pressure)

    • Mutagenesis of predicted catalytic residues with activity testing

    • Binding assays with predicted interaction partners

  • Genetic complementation strategies:

    • Heterologous expression in model organisms with deletions in putative homologs

    • Construction of chimeric proteins to identify functional domains

    • CRISPR-based manipulation in archaeal systems where available

  • Structural biology approaches:

    • Co-crystallization with putative substrates or binding partners

    • Nuclear magnetic resonance for detecting ligand interactions

    • Hydrogen-deuterium exchange mass spectrometry to identify binding regions

  • In vivo validation:

    • Generation of point mutations in the native M. jannaschii using the established genetic system

    • Phenotypic analysis under various stress conditions

    • Transcriptomic or proteomic profiling of mutant strains

Researchers should design experiments with appropriate controls that account for the extreme conditions under which M. jannaschii proteins naturally function.

What are the most promising future research directions for MJ1395?

Several high-impact research avenues for MJ1395 warrant consideration:

  • Integration into archaeal systems biology:

    • Network analysis to position MJ1395 within M. jannaschii's functional pathways

    • Multi-omics studies examining expression patterns under various environmental conditions

    • Comparison with homologs across archaeal lineages to trace evolutionary origins

  • Biotechnological applications:

    • Exploration of MJ1395's potential as a thermostable biocatalyst

    • Investigation of structural features conferring extreme stability for protein engineering

    • Development of biosensors for extreme environments based on MJ1395 properties

  • Fundamental archaeal biology:

    • Using MJ1395 as a model to understand archaeal-specific cellular processes

    • Investigation of potential roles in archaeal stress responses

    • Examination of possible involvement in methanogenesis or related metabolic pathways

  • Evolutionary implications:

    • Analysis of MJ1395 as a potential archaeal signature protein

    • Investigation of horizontal gene transfer events involving MJ1395

    • Structural comparisons with eukaryotic homologs to trace evolutionary relationships

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.