Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1403 (MJ1403)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methanocaldococcus jannaschii Uncharacterized Protein MJ1403 (MJ1403)

Recombinant Methanocaldococcus jannaschii Uncharacterized Protein MJ1403 (MJ1403) is a recombinant protein derived from the archaeon Methanocaldococcus jannaschii. This protein is expressed in Escherichia coli (E. coli) and is often used in research settings due to its unique characteristics and potential applications in biotechnology and molecular biology. Despite being uncharacterized, MJ1403 has garnered interest for its potential roles in various cellular processes.

Characteristics of Recombinant MJ1403 Protein

The recombinant MJ1403 protein is a full-length protein consisting of 374 amino acids, with a His-tag attached to its N-terminal end for easier purification and detection. It is typically provided in a lyophilized powder form and stored at -20°C or -80°C to maintain stability. The purity of this protein is generally greater than 90% as determined by SDS-PAGE, ensuring its suitability for various biochemical assays and research applications .

Amino Acid Sequence and Structure

The amino acid sequence of MJ1403 is crucial for understanding its potential functions and interactions. The sequence is as follows:

MTVSHGGILEGSSRGGKMMDWLKNKKAISPILALLIVLGVTIVVGAVFYAWGSNLFGNSQ EKTQAAVEGTATNMFYDAGAIRVAATCIDKIRYQDADDSDSWLGYPNGNGKIAKPSTSNG CYNSTYGTVFYDERFIVEIPVTIDTQDYKLTGVKVVGGIPKIVDMGGTYTNAFEDISAKF YAFWLHLNDNYQLLKKDGTLFVGYVNKSGMFEVSNGYVIAWNQTRDTYGKLASSVGATSD SSWDAVNTTTGVAPLVETSWPYYGTYCSNVKLYTATGEELKPGFGSGTLVAQWFCSSATY LDKLFNNPEYVVGTLPKNSEKTVKTYLFFNTLYLPNYKGSTNDGYVTFEVPLKVVSNEGV TKEVKVKFTVYDDE .

Understanding the primary structure is essential for predicting secondary, tertiary, and quaternary structures, which are crucial for determining the protein's function5.

Research Findings and Potential Applications

While specific functions of MJ1403 are not well-documented due to its uncharacterized nature, recombinant proteins like MJ1403 are often used in research to study protein-protein interactions, cellular processes, and potential therapeutic applications. The ability to express such proteins in E. coli allows for large-scale production and purification, facilitating detailed biochemical studies.

Potential Research Directions

  1. Protein-Protein Interactions: Studying interactions between MJ1403 and other proteins could reveal its role in cellular processes.

  2. Structural Biology: Determining the three-dimensional structure of MJ1403 could provide insights into its function and potential binding sites.

  3. Biotechnological Applications: The unique properties of MJ1403 might be exploited in biotechnology for novel enzyme development or as a tool in molecular biology research.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping is available upon request with additional charges; please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
MJ1403; Uncharacterized protein MJ1403
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-374
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1403
Target Protein Sequence
MTVSHGGILEGSSRGGKMMDWLKNKKAISPILALLIVLGVTIVVGAVFYAWGSNLFGNSQ EKTQAAVEGTATNMFYDAGAIRVAATCIDKIRYQDADDSDSWLGYPNGNGKIAKPSTSNG CYNSTYGTVFYDERFIVEIPVTIDTQDYKLTGVKVVGGIPKIVDMGGTYTNAFEDISAKF YAFWLHLNDNYQLLKKDGTLFVGYVNKSGMFEVSNGYVIAWNQTRDTYGKLASSVGATSD SSWDAVNTTTGVAPLVETSWPYYGTYCSNVKLYTATGEELKPGFGSGTLVAQWFCSSATY LDKLFNNPEYVVGTLPKNSEKTVKTYLFFNTLYLPNYKGSTNDGYVTFEVPLKVVSNEGV TKEVKVKFTVYDDE
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1403

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are suitable for producing recombinant MJ1403 protein?

Escherichia coli (E. coli) is the primary expression system used for producing recombinant MJ1403. This approach allows researchers to obtain sufficient quantities of the protein for structural and functional analyses. Based on available commercial information, recombinant MJ1403 with a histidine tag can be expressed using E. coli as the host organism .

Methodologically, when expressing archaeal proteins in bacterial systems, researchers should consider:

  • Codon optimization: The genetic code usage differs between archaea and bacteria, necessitating codon optimization for efficient expression.

  • Temperature considerations: Since M. jannaschii is hyperthermophilic, protein folding may be affected at E. coli's growth temperature. Some researchers employ a slower induction at lower temperatures to improve folding.

  • Tag selection: While His-tags are commonly used, the choice of affinity tag should be based on the specific experimental goals and the protein's characteristics.

For example, the MJ1447 gene from M. jannaschii has been successfully expressed using the pT7-7 plasmid system with NdeI and BamHI restriction sites . Similar approaches could be adapted for MJ1403 expression.

What purification methods are recommended for recombinant MJ1403?

Affinity chromatography is the primary method for purifying recombinant MJ1403, particularly when the protein is expressed with tags such as histidine or Strep tags. Based on similar approaches used for other M. jannaschii proteins, the following methodological workflow is recommended:

  • Initial capture: For His-tagged MJ1403, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins is effective.

  • Intermediate purification: Ion exchange chromatography can further purify the protein based on its theoretical isoelectric point.

  • Polishing step: Size exclusion chromatography helps achieve high purity and removes aggregates.

For example, in the purification of recombinant Mj-FprA (a different M. jannaschii protein with a 3xFLAG-twin Strep tag), a Streptactin XT superflow column eluted with 10 mM D-biotin was used, yielding 0.26 mg purified protein per liter culture . SDS-PAGE and Western blot analyses with anti-FLAG antibodies confirmed protein purity and tag presence.

When working with hyperthermophilic proteins, including heat treatment (60-80°C) as a purification step can be advantageous, as most E. coli proteins denature at these temperatures while archaeal proteins often remain stable.

How can researchers design experiments to determine the function of uncharacterized protein MJ1403?

Determining the function of an uncharacterized protein like MJ1403 requires a systematic experimental approach combining multiple techniques:

Experimental Design Framework:

  • Sequence-based analysis: Begin with bioinformatic approaches to identify conserved domains and structural motifs. Compare MJ1403 to characterized proteins in related organisms or with similar sequence features.

  • Structural studies: Determine the three-dimensional structure using X-ray crystallography, NMR, or cryo-EM to gain insights into potential functions based on structural homology.

  • Biochemical characterization: Design assays to test predicted enzymatic activities based on sequence and structural analyses.

  • Genetic approaches: When implementing a genetic system for M. jannaschii:

    • Consider gene knockout or knockdown studies to observe phenotypic changes

    • Use the recently developed genetic systems for M. jannaschii that employ mevinolin resistance (P*sla-hmgA*) as a selectable marker

    • Follow a double recombination process for gene replacement as demonstrated for other genes in M. jannaschii

  • Interaction studies: Identify protein-protein interactions using pull-down assays, co-immunoprecipitation, or yeast two-hybrid screening to place MJ1403 in a functional context.

Variables Control in Experiments:

When designing experiments, control both independent and dependent variables carefully:

  • Independent variables: Expression conditions, substrate concentrations, temperature, pH

  • Dependent variables: Enzymatic activity, binding affinity, phenotypic changes

  • Extraneous variables: Strain background, media composition, growth conditions

True experimental designs should include:

  • Control groups vs. experimental groups with random assignment

  • Systematic manipulation of independent variables

  • Random distribution of variables to control for extraneous factors

What genetic manipulation techniques are applicable for studying MJ1403 in Methanocaldococcus jannaschii?

Recent advances have established genetic systems for M. jannaschii that can be adapted to study MJ1403. These methodological approaches include:

  • Selectable markers: The P*sla-hmgA* cassette confers resistance to mevinolin (or simvastatin) and can be used as a selection marker. M. jannaschii strain BM10, which has this marker inserted via double recombination, shows resistance to simvastatin at 10 μM while the wild type is inhibited .

  • Transformation protocol: M. jannaschii transformation requires heat shock treatment rather than chemical methods like polyethylene glycol or liposomes used for other methanogens. This approach is more cost-effective and faster, with colonies appearing on solid medium in 3-4 days compared to 7 days for M. maripaludis and 14 days for Methanosarcina species .

  • Recombination strategy: For studying MJ1403, researchers should design suicide plasmids containing:

    • DNA elements representing upstream and coding regions of MJ1403

    • Selectable marker (P*sla-hmgA*)

    • Affinity tags if protein purification is needed

  • Vector linearization: Using linearized suicide vectors prevents the formation of merodiploid cells through single crossover events. For MJ1403 studies, the suicide plasmid should be linearized before transformation .

  • Verification methods: Successful transformants should be verified through:

    • PCR-based analysis of genomic DNA

    • Sequencing of amplicons to confirm correct integration

    • Phenotypic characterization (growth on selective media)

What advanced approaches can be used to analyze potential enzymatic activities of MJ1403?

To investigate potential enzymatic activities of MJ1403, researchers should employ a systematic approach combining computational predictions with experimental validation:

Computational Analysis Pipeline:

  • Homology detection: Use sensitive sequence comparison tools like HHpred, HMMER, or AlphaFold to detect distant homologs with known functions.

  • Structural prediction: Generate structural models of MJ1403 using AlphaFold2 or RoseTTAFold, then compare with known enzyme structures using tools like DALI or TM-align.

  • Active site prediction: Analyze conserved residues and potential binding pockets to identify candidate active sites.

Experimental Validation Methodology:

  • Activity screening panels: Test purified recombinant MJ1403 against diverse substrate panels based on computational predictions.

  • Coupled enzyme assays: Design spectrophotometric assays that couple potential MJ1403 activity to detectable changes (e.g., NAD(P)H oxidation/reduction).

  • Metabolic labeling: Use isotope-labeled substrates to track potential transformations catalyzed by MJ1403.

  • Thermostable enzyme considerations: When designing assays, account for the hyperthermophilic nature of M. jannaschii proteins:

    • Conduct assays at elevated temperatures (65-85°C)

    • Use thermostable coupling enzymes and buffers

    • Consider pressure effects, as M. jannaschii is a deep-sea organism

  • Statistical analysis: Implement robust statistical methods to analyze enzymatic data:

    • Use appropriate controls for background activity

    • Apply multiple replicates (n≥3) for each condition

    • Perform detailed kinetic analyses if activity is detected

For example, the F420H2 oxidase activity of Mj-FprA (another M. jannaschii protein) was successfully characterized at 70°C with oxygen and F420H2 at concentrations of 20 and 40 μM, respectively, yielding a specific activity of 2,100 μmole/min/mg .

How can researchers investigate potential roles of MJ1403 in central metabolism of M. jannaschii?

Investigating MJ1403's potential role in M. jannaschii's central metabolism requires a multi-faceted approach:

Metabolic Context Analysis:

  • Pathway mapping: Analyze MJ1403 in the context of known M. jannaschii metabolic pathways. For instance, M. jannaschii possesses genes for both a complete nonoxidative pentose phosphate pathway and an RuMP pathway, which might be relevant for contextualizing MJ1403 .

  • Transcriptional analysis: Examine whether MJ1403 is part of an operon (polycistronic mRNA) or expressed as a monocistronic mRNA. This information can provide clues about functional relationships with other genes, as seen with the analysis of Mj_0748 and Mj_0732 .

Experimental Approaches:

  • Gene knockout/knockdown studies: Use the genetic system developed for M. jannaschii to create MJ1403 deletion or knockdown strains, then:

    • Analyze growth phenotypes under various conditions

    • Perform metabolomic analysis to identify accumulated or depleted metabolites

    • Use 13C-labeling to trace carbon flux changes

  • Complementation experiments: Express MJ1403 in knockout strains to confirm phenotype rescue.

  • Heterologous expression: Express MJ1403 in model organisms lacking similar proteins to observe functional complementation.

  • Comparative analysis: Compare M. jannaschii wild-type and MJ1403 mutant strains for differences in:

    • Growth rate and yield

    • Substrate utilization

    • Metabolite profiles

    • Response to environmental stressors

For rigorous experimental design, incorporate:

  • Randomization to reduce selection bias

  • Blinding for subjective assessments

  • Appropriate controls for all variables

  • Factorial designs to test multiple factors simultaneously

What analytical techniques are most suitable for studying structure-function relationships of MJ1403?

Understanding the structure-function relationship of MJ1403 requires sophisticated analytical techniques appropriate for hyperthermophilic archaeal proteins:

Structural Analysis Methods:

Functional Analysis Integration:

  • Site-directed mutagenesis: Systematic mutation of conserved residues identified from structural analysis to determine their role in function. Key methodological considerations:

    • Design mutations based on structural information

    • Express mutant proteins in the same system as wild-type for valid comparisons

    • Analyze effects on stability, folding, and activity

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify flexible regions and potential binding sites.

  • Thermal shift assays: To assess protein stability and ligand binding, particularly relevant for thermophilic proteins.

  • Computational molecular dynamics: Simulate protein behavior at high temperatures to understand thermal stability mechanisms.

Experimental Design Considerations:

When designing structure-function experiments, researchers should:

  • Control for temperature effects on both structure and function

  • Compare MJ1403 behavior across a range of temperatures (25-85°C)

  • Include appropriate thermostable control proteins

  • Consider pressure effects, as M. jannaschii is a deep-sea organism

For validation of structural predictions, combine multiple methods such as circular dichroism spectroscopy, limited proteolysis, and cross-linking studies to provide complementary data about protein structure and dynamics under native-like conditions.

How should researchers design controls for experiments with recombinant MJ1403?

Designing appropriate controls is critical for experiments involving recombinant MJ1403. A systematic approach includes:

Positive and Negative Controls:

  • Expression controls:

    • Positive control: Express a well-characterized M. jannaschii protein (e.g., Mj-FprA) using the same system

    • Negative control: Expression host containing empty vector

  • Purification controls:

    • Column matrix controls: Pass buffer through the affinity column prior to sample loading

    • Tag controls: Express and purify tag-only constructs to identify tag-specific artifacts

  • Activity assays:

    • Substrate-only controls to measure spontaneous reactions

    • Heat-inactivated enzyme controls (particularly important for thermostable enzymes)

    • Known enzyme controls that catalyze similar reactions

Experimental Design Controls:

  • Randomization: Randomly assign samples to experimental groups to minimize bias. This is particularly important when qualitative assessments are involved .

  • Blinding: When conducting subjective measurements, use blinding to prevent researcher bias. Only 14% of experimental papers report using blinding when making qualitative assessments, despite its importance in reducing bias .

  • Factorial design: When testing multiple variables, use factorial designs to maximize efficiency and information gain. Only 62% of studies that could benefit from factorial design reported using one .

For rigorous experimental design, researchers should:

  • Report randomization methods used (only 9% of studies that use randomization provide method details)

  • Implement positive and negative controls for each experimental step

  • Include technical replicates (same sample measured multiple times) and biological replicates (different samples from the same experimental group)

  • Standardize all protocols and quality control metrics

What are the best approaches for analyzing conflicting or unexpected results when studying MJ1403?

When faced with conflicting or unexpected results in MJ1403 research, a systematic analytical approach is essential:

Methodological Troubleshooting Framework:

  • Experimental validation:

    • Repeat experiments with increased sample sizes to improve statistical power

    • Vary experimental conditions systematically to identify factors influencing results

    • Use alternative methods to test the same hypothesis from different angles

  • Technical verification:

    • Confirm protein identity using mass spectrometry (as done with Mj-FprA, where analysis identified 41 peptides accounting for 55% of the primary structure)

    • Verify protein integrity using SDS-PAGE and Western blotting

    • Check for post-translational modifications or degradation

  • Control reassessment:

    • Review all controls to ensure they're appropriate and functioning as expected

    • Add additional controls targeted at the specific unexpected results

Data Analysis Strategies:

  • Statistical re-evaluation:

    • Apply appropriate statistical tests based on data distribution

    • Consider using more robust statistical methods

    • Analyze potential outliers properly rather than simply removing them

  • Literature comparison:

    • Compare results with similar proteins in M. jannaschii or related organisms

    • Consider whether the conflicts align with known biological variation

  • Hypothesis revision:

    • Formulate new hypotheses that account for unexpected results

    • Design targeted experiments to test revised hypotheses

Documentation and Reporting:

For transparent science, researchers should:

  • Document all unexpected results thoroughly

  • Report both confirming and conflicting data

  • Discuss potential explanations for discrepancies

  • Share raw data to enable reanalysis by others

For example, when studying M. jannaschii proteins, unexpected results might arise from the organism's unique adaptations to extreme environments. The high growth temperature (optimal at 85°C) and pressure conditions of its natural habitat could lead to protein behaviors different from those predicted based on mesophilic homologs.

How can researchers optimize expression conditions for recombinant MJ1403 to maximize functional protein yield?

Optimizing expression conditions for functional recombinant MJ1403 requires a systematic approach addressing the challenges specific to archaeal hyperthermophilic proteins:

Expression Parameter Optimization:

  • Host selection:

    • Standard E. coli strains (BL21(DE3), Rosetta2) for initial trials

    • Specialized strains for codon optimization (Rosetta, CodonPlus)

    • Consider archaeal hosts for difficult cases

  • Vector optimization:

    • Test multiple promoters (T7, tac, araBAD) for expression level control

    • Compare different fusion tags (His, GST, MBP, SUMO) for solubility enhancement

    • Evaluate tag position (N-terminal vs. C-terminal)

  • Growth conditions matrix:

    • Temperature: Test expression at 16°C, 25°C, and 30°C (lower temperatures often improve folding)

    • Induction timing: Early log phase vs. mid-log phase

    • Inducer concentration: Titrate IPTG (0.01-1.0 mM) or other inducers

    • Media composition: Compare rich media (LB, TB) vs. defined media (M9)

Experimental Design Approach:

Implement a factorial design to efficiently test multiple variables simultaneously . For example:

TemperatureIPTG ConcentrationInduction OD600Media Type
16°C0.1 mM0.6LB
16°C0.5 mM0.8TB
25°C0.1 mM0.8LB
25°C0.5 mM0.6TB

For each condition, measure:

  • Total protein expression (SDS-PAGE)

  • Soluble fraction percentage

  • Purification yield

  • Functional activity

Solubility Enhancement Strategies:

  • Co-expression with chaperones: GroEL/ES, DnaK/J, or archaeal chaperones

  • Lysis buffer optimization:

    • Test different pH ranges (7.0-8.5)

    • Evaluate salt concentrations (100-500 mM NaCl)

    • Include stabilizing additives (5-10% glycerol, 0.1-1.0 M arginine)

  • Refolding approaches: If inclusion bodies form, develop a refolding protocol using gradual dialysis or on-column refolding

Based on the experience with other M. jannaschii proteins, researchers should anticipate relatively low yields compared to mesophilic proteins. For reference, the yield of purified Mj-FprA was 0.26 mg per liter of culture , suggesting that scale-up strategies might be necessary for obtaining sufficient amounts of MJ1403 for extensive characterization.

What are the considerations for designing experiments to study MJ1403 interactions with other proteins or substrates?

Investigating MJ1403 interactions requires carefully designed experiments that account for the unique characteristics of this archaeal protein:

Interaction Screening Approaches:

  • Pull-down assays:

    • Use MJ1403 with affinity tags as bait

    • Extract potential partners from M. jannaschii lysates

    • Consider crosslinking to stabilize transient interactions

    • Control for non-specific binding with tag-only proteins

  • Yeast two-hybrid systems:

    • Consider high-temperature Y2H systems for thermophilic proteins

    • Use both N- and C-terminal fusions to activation/binding domains

    • Include appropriate positive and negative controls

    • Validate interactions with orthogonal methods

  • Surface plasmon resonance (SPR):

    • Immobilize MJ1403 using appropriate chemistry

    • Test potential interactors at various concentrations

    • Analyze binding kinetics (kon, koff, KD)

    • Perform experiments at elevated temperatures when possible

Substrate Screening Methodologies:

  • Activity-based screening:

    • Design assays based on predicted functions

    • Use substrate panels to test multiple candidates

    • Include proper controls for spontaneous reactions

  • Thermal shift assays:

    • Monitor protein stability in presence of potential substrates

    • Look for stabilizing effects indicative of binding

    • Perform at multiple temperatures to identify optimal conditions

  • Isothermal titration calorimetry (ITC):

    • Directly measure thermodynamic parameters of binding

    • Particularly suitable for thermophilic proteins

    • Can determine stoichiometry and binding mechanism

Experimental Design Considerations:

  • Temperature effects:

    • Conduct interaction studies at physiologically relevant temperatures (65-85°C)

    • Compare with standard conditions (25-37°C) to assess temperature dependence

    • Use temperature-stable buffers and equipment

  • Buffer optimization:

    • Test multiple pH values around the predicted optimum

    • Vary salt concentrations to mimic physiological conditions

    • Include stabilizing agents if necessary

  • Statistical validation:

    • Perform at least three independent replicates

    • Use appropriate statistical tests to evaluate significance

    • Plot complete data sets rather than only showing means

For example, when studying the F420H2 oxidase activity of Mj-FprA, researchers conducted assays at 70°C with specific concentrations of oxygen (20 μM) and F420H2 (40 μM), demonstrating the importance of temperature and substrate concentration optimization .

What statistical approaches are most appropriate for analyzing experimental data from MJ1403 studies?

Selecting appropriate statistical methods is critical for rigorous analysis of MJ1403 experimental data:

Experimental Design and Statistical Planning:

  • Power analysis: Determine appropriate sample sizes before beginning experiments by considering:

    • Expected effect size

    • Desired statistical power (typically 0.8 or higher)

    • Significance level (typically α = 0.05)

    • Variability in preliminary data

  • Randomization: Implement proper randomization to reduce selection bias in experiments . This should include:

    • Random allocation of samples to treatment groups

    • Random ordering of experimental procedures

    • Documentation of randomization methods used

Data Analysis Framework:

  • Descriptive statistics:

    • Central tendency measures (mean, median)

    • Dispersion measures (standard deviation, interquartile range)

    • Data visualization (box plots, scatter plots)

  • Inferential statistics:

    • For comparing two groups: t-tests (parametric) or Mann-Whitney U tests (non-parametric)

    • For multiple groups: ANOVA with appropriate post-hoc tests (Tukey, Bonferroni)

    • For relationships: correlation and regression analyses

  • Specialized analyses for biochemical data:

    • Enzyme kinetics: non-linear regression for Michaelis-Menten parameters

    • Binding studies: equilibrium and kinetic binding models

    • Thermal stability: Boltzmann sigmoid fitting for melting temperatures

Avoiding Common Statistical Pitfalls:

For example, when analyzing enzymatic activity data for MJ1403, researchers should perform replicate measurements (n≥3), report means with standard deviations, and apply appropriate statistical tests to compare activities under different conditions.

How can researchers integrate computational predictions and experimental data when studying MJ1403 function?

Integrating computational predictions with experimental data creates a powerful approach for elucidating MJ1403 function:

Data Integration Framework:

  • Sequential approach:

    • Start with computational predictions to generate hypotheses

    • Design targeted experiments to test predictions

    • Refine computational models based on experimental results

    • Iterate through this cycle to converge on function

  • Parallel approach:

    • Conduct computational analyses and experimental studies simultaneously

    • Compare results to identify convergent evidence

    • Resolve discrepancies through additional analyses or experiments

Computational Prediction Methods:

  • Sequence-based analysis:

    • Homology detection using sensitive tools (PSI-BLAST, HMM profiles)

    • Domain and motif identification (InterProScan, PFAM)

    • Co-evolution analysis to predict functional residues

  • Structure-based prediction:

    • Ab initio modeling using AlphaFold2 or RoseTTAFold

    • Active site prediction based on structural features

    • Molecular docking to identify potential ligands

  • Systems biology approaches:

    • Gene neighborhood analysis

    • Protein-protein interaction network prediction

    • Metabolic pathway gap analysis

Experimental Validation Strategies:

  • Targeted experiments based on computational predictions:

    • Site-directed mutagenesis of predicted functional residues

    • Testing predicted substrates or interaction partners

    • Structural studies focused on predicted functional regions

  • High-throughput screening for unbiased discovery:

    • Activity assays against diverse substrate libraries

    • Interaction screens with M. jannaschii proteome

    • Phenotypic analysis of MJ1403 mutants

Case Study Approach:

Consider the analogous research on the MJ1447-encoded enzyme from M. jannaschii:

  • Computational analysis identified domains homologous to formaldehyde-activating enzyme and 3-hexulose-6-phosphate synthase

  • Experimental studies confirmed the predicted enzymatic activity

  • The integrated approach led to understanding its role in ribose-5-phosphate biosynthesis

When reporting results, present both computational predictions and experimental data in an integrated manner, clearly indicating which aspects were predicted versus experimentally verified, and explicitly discussing any discrepancies between the two approaches.

What are the key challenges in interpreting results from MJ1403 studies in an evolutionary context?

Interpreting MJ1403 research within an evolutionary framework presents several unique challenges:

Phylogenetic Context Challenges:

  • Ancient lineage interpretation:

    • M. jannaschii belongs to a deeply rooted methanogenic archaeon lineage

    • Distinguishing ancestral from derived features requires careful comparative analysis

    • Limited availability of characterized homologs from equally ancient lineages

  • Horizontal gene transfer detection:

    • Archaeal genomes show evidence of horizontal gene transfer events

    • MJ1403 might represent a laterally acquired gene

    • Potential fusion events complicating evolutionary history, as seen with the Fsr gene in M. jannaschii

  • Functional evolution tracking:

    • Proteins may change function while maintaining structural similarity

    • Need to distinguish homology (shared ancestry) from analogy (convergent evolution)

    • Rates of sequence vs. functional evolution may differ

Methodological Approaches:

  • Comprehensive phylogenetic analysis:

    • Construct phylogenies using multiple methods (Maximum Likelihood, Bayesian)

    • Include diverse taxa spanning all domains of life

    • Test alternative tree topologies to assess robustness

  • Ancestral sequence reconstruction:

    • Infer ancestral sequences at key phylogenetic nodes

    • Express and characterize reconstructed ancestral proteins

    • Compare properties with modern MJ1403

  • Structural comparisons across domains:

    • Compare MJ1403 structural features with bacterial and eukaryal homologs

    • Identify conserved vs. lineage-specific elements

    • Use structure-guided sequence alignment for distant homologs

Integration Strategies:

For rigorous evolutionary interpretation, researchers should apply multiple phylogenetic methods, test alternative hypotheses explicitly, and integrate functional experimental data with evolutionary analyses.

What resources and databases are most valuable for researchers studying MJ1403?

Researchers studying MJ1403 should utilize a comprehensive set of specialized databases and resources:

Protein-Specific Resources:

  • Primary sequence databases:

    • UniProtKB/Swiss-Prot: Entry Q58798 contains curated information about MJ1403

    • NCBI Protein: Contains raw sequence data and features

    • RefSeq: Provides reference protein sequences and annotations

  • Structure databases:

    • Protein Data Bank (PDB): For structures of homologous proteins

    • AlphaFold DB: Contains predicted structures for M. jannaschii proteins

    • SWISS-MODEL Repository: Homology models based on template structures

  • Functional annotation databases:

    • InterPro: Integrated resource for protein families and domains

    • PFAM: Database of protein families and domains

    • KEGG: Metabolic pathway information for M. jannaschii

Organism-Specific Resources:

  • Genome browsers:

    • NCBI Genome: Complete genome sequence for M. jannaschii

    • JGI GOLD: Genome information and metadata

    • UCSC Archaeal Genome Browser: Visualization and comparison tools

  • Archaeal-specific databases:

    • ArchaeaDB: Specialized database for archaeal genomics

    • HaloWeb: Resource for halophilic archaea (includes comparative tools)

    • BRITE Hierarchy: KEGG-based functional hierarchies for archaeal genes

Methodological Resources:

  • Expression and purification protocols:

    • Research papers describing successful expression of M. jannaschii proteins

    • Protein Expression Database (PED): Collects expression and purification data

    • Structural Genomics Consortium: Standardized protocols for difficult proteins

  • Genetic manipulation resources:

    • Protocols for transformation of M. jannaschii

    • Vector databases for archaeal expression systems

    • Addgene: Repository of plasmids including archaeal genetic tools

Data Analysis Tools:

  • Sequence analysis:

    • BLAST: For identifying similar sequences

    • MUSCLE or MAFFT: For multiple sequence alignment

    • MEGA or RAxML: For phylogenetic analysis

  • Structure analysis:

    • PyMOL or Chimera: For structural visualization and analysis

    • DALI or TM-align: For structural comparison

    • FTMap: For binding site prediction

  • Integrated analysis platforms:

    • Jalview: For integrated sequence-structure analysis

    • InterMine: For integrating multiple data types

    • KBase: For systems biology analyses

When utilizing these resources, researchers should cross-reference information from multiple databases, as annotation quality and completeness can vary significantly for archaeal proteins like MJ1403.

What methodological advances have improved our ability to study proteins from hyperthermophilic archaea like M. jannaschii?

Recent methodological advances have significantly enhanced our ability to study proteins from hyperthermophilic archaea like M. jannaschii:

Genetic System Developments:

  • Transformation protocols:

    • Heat shock methods for M. jannaschii transformation, avoiding expensive chemicals like polyethylene glycol and liposomes

    • Faster colony generation (3-4 days) compared to other methanogens (7-14 days)

  • Selectable markers:

    • Development of the P*sla-hmgA* cassette conferring mevinolin/simvastatin resistance

    • Verification that simvastatin (10 μM) can replace mevinolin for selection

  • Recombination strategies:

    • Use of linearized suicide vectors to prevent merodiploid formation

    • Double crossover homologous recombination techniques for precise genome modifications

Expression and Purification Advances:

  • Homologous expression systems:

    • Development of M. jannaschii strains that overexpress target proteins with affinity tags

    • Expression under control of engineered promoters like P*flaB1B2*

  • Affinity purification improvements:

    • Use of twin Strep tags for efficient purification under high-temperature conditions

    • Integration of 3xFLAG tags for detection and purification

  • Thermostable enzymes and reagents:

    • Development of thermostable DNA polymerases for PCR with M. jannaschii templates

    • Thermostable chromatography matrices for high-temperature purification

Structural Biology Methods:

  • Cryo-EM advances:

    • Direct electron detectors improving resolution

    • Methods for studying smaller proteins (<100 kDa)

    • Sample preparation techniques for thermophilic proteins

  • Crystallography improvements:

    • Microfocus beamlines for smaller crystals

    • In situ crystallization methods

    • Room-temperature data collection reducing artifacts

  • NMR advancements:

    • Higher field magnets improving resolution

    • Improved labeling strategies for larger proteins

    • Non-uniform sampling techniques reducing acquisition time

Computational Methods:

  • Structure prediction:

    • AI-based methods like AlphaFold2 dramatically improving accuracy

    • Specialized force fields for hyperthermophilic proteins

    • Integrative modeling approaches combining multiple data sources

  • Molecular dynamics simulations:

    • Enhanced sampling techniques for studying high-temperature dynamics

    • Specialized parameters for archaeal-specific lipids and cofactors

    • Longer timescales accessible through improved hardware and algorithms

These methodological advances collectively enable more comprehensive studies of proteins like MJ1403, with particular importance placed on the genetic systems that allow in vivo functional studies in the native organism.

How should researchers prepare samples of recombinant MJ1403 for structural and functional studies?

Proper sample preparation is critical for successful structural and functional studies of recombinant MJ1403:

Purification Optimization:

  • Buffer composition:

    • Test multiple buffers (HEPES, Tris, phosphate) at pH 7.0-8.5

    • Include stabilizing agents (5-20% glycerol, 1-5 mM DTT)

    • Optimize salt concentration (100-500 mM NaCl)

    • Consider adding specific cofactors or metal ions based on predicted function

  • Multi-step purification strategy:

    • Initial capture: Affinity chromatography (IMAC for His-tagged MJ1403)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

    • Quality control: SDS-PAGE, Western blotting, mass spectrometry

  • Thermal stability considerations:

    • Heat treatment (60-80°C) to remove E. coli proteins if expressed heterologously

    • Analyze thermal stability using differential scanning fluorimetry

    • Determine optimal storage and handling temperatures

Sample Preparation for Structural Studies:

  • X-ray crystallography:

    • Concentrate to 5-20 mg/mL using appropriate molecular weight cutoff

    • Remove aggregates by centrifugation (100,000 × g for 30 min)

    • Screen crystallization conditions at both room temperature and 4°C

    • Consider surface entropy reduction mutations if crystallization fails

  • Cryo-EM:

    • Optimize protein concentration (typically 0.5-5 mg/mL)

    • Test multiple grid types and freezing conditions

    • Evaluate sample homogeneity by negative staining prior to cryo-freezing

    • Consider GraFix method for stabilizing protein complexes

  • NMR spectroscopy:

    • Express in minimal media with isotope labeling (15N, 13C, 2H)

    • Concentrate to 0.2-1.0 mM in low-salt buffer

    • Add 5-10% D2O for lock signal

    • Test different temperatures for optimal spectral quality

Functional Assay Preparation:

  • Enzyme activity measurements:

    • Determine protein concentration accurately using multiple methods

    • Remove any potential inhibitors through buffer exchange

    • Prepare fresh immediately before assays or determine stability at storage conditions

    • Include thermostable controls when designing assays at elevated temperatures

  • Binding studies:

    • Remove any co-purifying ligands through extensive dialysis

    • Validate protein folding using circular dichroism or fluorescence spectroscopy

    • Prepare protein and ligand samples in identical buffers to avoid artifacts

    • Determine concentration-dependent effects by testing serial dilutions

For all applications, researchers should verify protein identity and integrity using mass spectrometry, as demonstrated with Mj-FprA where analysis identified 41 peptides accounting for 55% of the primary structure .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.