Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1417.1 (MJ1417.1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ1417.1; Uncharacterized protein MJ1417.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1417.1
Target Protein Sequence
MYLIWIIGGGQKDLTNKILDEIKKLYEQLDEIKDKNINSSNVQLNEFMRQNVNMLKELNQ KIDKYLENNNEILKEMEKYVKEDIEHKNRMERKLKQISMLLLIVIIAIGLTISYMVILNN EYLSTQLFNYIQIAIQYLKSLLSNY
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for research?

Methanocaldococcus jannaschii is an autotrophic archaeon originally isolated from a submarine hydrothermal vent at the East Pacific Rise. This hyperthermophilic methanogen grows at pressures up to 500 atm and temperatures between 48-94°C, with an optimal growth temperature near 85°C . As one of the first archaeal genomes sequenced, M. jannaschii has been critical in establishing a comprehensive comparative evolutionary framework for understanding the molecular basis of cellular life origins and diversification .

The organism's significance stems from:

  • Its position in a phylogenetically deeply rooted branch of the Archaea

  • Its adaptation to extreme conditions (high temperature, high pressure)

  • Its complete genome sequence (1.66-megabase pair chromosome plus 58- and 16-kilobase pair extrachromosomal elements)

  • The identification of 1738 predicted protein-coding genes, many uncharacterized

When working with this organism, researchers should note that cultures grow rapidly, typically reaching stationary phase within hours, requiring monitoring at regular intervals rather than overnight incubation .

How can researchers obtain and culture M. jannaschii for protein studies?

M. jannaschii (strain DSM 2661) can be obtained from culture collections such as DSMZ (Deutsche Sammlung von Mikroorganismen und Zellkulturen) and maintained using the following protocol :

Culture conditions:

  • Medium 282 (specific for methanogens)

  • Temperature: 80°C

  • Strictly anaerobic conditions

  • Special instructions for cultivation of anaerobes, hyperthermophiles, and methanogens must be followed

Important cultivation notes:

  • Cultures grow rapidly with a doubling time of approximately 26 minutes

  • They typically reach stationary phase within hours, requiring regular monitoring

  • Overnight incubation should be avoided

  • A gas mixture of H₂ and CO₂ (80:20, v/v; 3 × 10⁵ Pa) in the headspace is required

  • Growth must be checked at regular intervals due to the rapid growth rate

Due to the challenges associated with culturing M. jannaschii, many researchers prefer working with recombinant proteins expressed in more tractable systems such as E. coli rather than extracting them directly from the native organism .

What are the most effective systems for recombinant expression of MJ1417.1?

The most commonly used expression system for M. jannaschii proteins, including MJ1417.1, is E. coli with the pET expression vector system. Based on published protocols for similar M. jannaschii proteins, the following expression strategy is recommended :

Expression system components:

  • Host: E. coli BL21(DE3)

  • Vector: pET28a (provides an N-terminal His-tag)

  • Induction: IPTG (isopropyl-β-D-thiogalactopyranoside) at 0.5-1.0 mM when OD₆₀₀ reaches 0.7

  • Expression temperature: 37°C for 4 hours with shaking

Homologous expression alternative:
For researchers interested in native folding and post-translational modifications, a homologous expression system in M. jannaschii has been developed . This involves:

  • Construction of a suicide plasmid containing the gene of interest with affinity tags

  • Linearization of the plasmid using restriction enzymes (e.g., XmnI)

  • Transformation into M. jannaschii via heat shock (85°C for 45 seconds)

  • Selection of transformants using mevinolin resistance markers

  • The yield from homologous expression is typically lower (0.26 mg/L) compared to E. coli systems

What purification protocol provides optimal yield and purity for recombinant MJ1417.1?

Based on published protocols for other M. jannaschii proteins, the following purification strategy should be effective for His-tagged MJ1417.1 :

Purification protocol:

  • Cell lysis: Resuspend cells in lysis buffer (50 mM Tris pH 8.0, 300 mM NaCl, 20 mM 2-mercaptoethanol, 20 mM imidazole)

  • Sonication: Sonicate cell suspension and centrifuge to remove debris

  • IMAC purification: Load supernatant onto a Ni-NTA column

  • Washing: Wash column with lysis buffer to remove non-specifically bound proteins

  • Elution: Elute the target protein using an imidazole gradient (50-250 mM)

  • Quality control: Verify purity by SDS-PAGE (10% gel)

  • Protein quantification: Estimate concentration using the Bradford method with BSA as standard

For recombinant proteins with Strep-tags, Streptactin XT superflow columns can be used with elution using 10 mM D-biotin .

Protein storage considerations:

  • Store in Tris-based buffer with 50% glycerol

  • For short-term storage, maintain at -20°C

  • For long-term storage, use -80°C

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

How can researchers overcome common challenges in archaeal protein expression?

Recombinant expression of archaeal proteins, particularly from hyperthermophiles like M. jannaschii, presents several challenges due to differences in codon usage, protein folding machinery, and post-translational modifications . Strategies to overcome these challenges include:

ChallengeSolution StrategyImplementation Details
Codon biasCodon optimizationSynthesize gene with codons optimized for E. coli usage
Protein misfoldingCo-expression with chaperonesInclude plasmids encoding GroEL/ES or other chaperone systems
InsolubilityFusion tagsUse solubility-enhancing tags such as SUMO, MBP, or GST
Post-translational issuesReduced expression temperatureLower temperature to 18-25°C after induction
Protein instabilityStabilizing additivesInclude glycerol, specific ions, or substrate analogs in buffers
Low expression levelsAlternative promotersTest T7, tac, or arabinose-inducible promoters
Protein toxicityTight expression controlUse systems with stringent repression in uninduced state

For specific M. jannaschii proteins that remain challenging to express in E. coli, researchers have developed a genetic system for homologous expression directly in M. jannaschii. This system involves transformation via heat shock and selection using mevinolin resistance, though yields are typically lower than heterologous expression .

What computational approaches can predict structure and function of MJ1417.1?

Given the limited experimental data on MJ1417.1's structure and function, computational approaches provide valuable initial insights. Researchers can use the following methods:

Sequence-based analyses:

  • Homology detection: Search for remote homologs using PSI-BLAST, HHpred, or HMMER

  • Domain prediction: Identify functional domains using InterPro, Pfam, or SMART

  • Secondary structure prediction: Predict structural elements using PSIPRED or JPred

  • Transmembrane topology: Tools like TMHMM and Phobius predict membrane-spanning regions

  • Disorder prediction: DISOPRED or IUPred can identify intrinsically disordered regions

3D structure prediction:

  • Homology modeling: If suitable templates exist (typically >30% sequence identity)

  • Threading: For more distant relationships using tools like I-TASSER or Phyre2

  • Ab initio modeling: AlphaFold2 or RoseTTAFold for template-free modeling

  • Molecular dynamics: Simulations to refine models and predict conformational changes

Functional prediction:

  • Binding site prediction: Tools like 3DLigandSite or COACH

  • Gene neighborhood analysis: Examine genomic context for functional clues

  • Phylogenetic profiling: Identify co-evolving proteins that may function together

The sequence analysis of MJ1417.1 suggests it may contain transmembrane domains, indicating a potential membrane-associated function that would be consistent with its sequence characteristics .

What experimental approaches are most effective for determining the function of uncharacterized archaeal proteins like MJ1417.1?

A multi-faceted experimental approach is recommended for characterizing proteins like MJ1417.1:

Biochemical characterization:

  • Activity assays: Screen for enzymatic activities based on predicted function or using substrate libraries

  • Cofactor identification: Analyze bound cofactors using spectroscopic methods

  • Substrate binding: Employ isothermal titration calorimetry or surface plasmon resonance

  • Thermal stability: Characterize using differential scanning calorimetry, particularly relevant for thermophilic proteins

Structural studies:

Genetic approaches:

  • Gene knockout: Using the recently developed genetic system for M. jannaschii

  • Tagged proteins: For localization studies or pull-down assays

  • Complementation studies: Express in heterologous systems lacking similar function

Based on successful studies with other M. jannaschii proteins, such as the F₄₂₀H₂ oxidase (FprA) and adenine deaminase, a combination of recombinant expression, biochemical characterization, and structural studies has proven effective .

How do researchers analyze potential interaction partners for MJ1417.1?

Identifying protein-protein interactions is crucial for understanding the biological role of uncharacterized proteins like MJ1417.1. Several approaches can be employed:

In silico methods:

  • Co-evolution analysis: Tools like EVcomplex detect residues that co-evolve across protein families

  • Docking studies: Computational docking to predict potential binding partners

  • Genome context methods: Examine gene neighborhood, gene fusion, and phylogenetic profiles

Experimental methods:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express MJ1417.1 with affinity tags (His, FLAG, or Strep-tag)

    • Purify protein complexes under native conditions

    • Identify interacting partners by mass spectrometry

  • Yeast two-hybrid screening:

    • Though challenging for archaeal proteins, can be adapted with appropriate controls

    • May require domain-specific approaches if transmembrane regions are present

  • Proximity-based labeling:

    • BioID or APEX2 fusion proteins can identify proteins in the vicinity

    • Particularly useful for membrane-associated proteins

  • Cross-linking mass spectrometry:

    • Chemical cross-linking stabilizes transient interactions

    • Especially valuable for thermophilic proteins where interactions may be unstable at lower temperatures

When working with M. jannaschii proteins, researchers should consider that physiologically relevant interactions may only occur under conditions that mimic the extreme environment of the organism (high temperature, high pressure) .

How can genetic modification systems for M. jannaschii be used to study MJ1417.1 function in vivo?

A genetic system for M. jannaschii has been developed that allows chromosomal modification through homologous recombination . This system can be applied to study MJ1417.1 function using the following methodologies:

Gene knockout approach:

  • Construct a suicide plasmid (e.g., pDS210) containing:

    • ~500 bp upstream region of MJ1417.1

    • Selectable marker (P-sla-hmgA cassette conferring mevinolin resistance)

    • ~500 bp downstream region of MJ1417.1

  • Linearize the plasmid using restriction enzymes (e.g., XmnI)

  • Transform M. jannaschii using the heat shock method (85°C for 45 seconds)

  • Select transformants on medium containing mevinolin (10 μM)

  • Verify gene deletion via PCR and phenotypic analysis

Protein tagging and overexpression:

  • Create a construct similar to what was used for FprA (MJ_0748):

    • Upstream region of MJ1417.1

    • Modified version of MJ1417.1 with affinity tags (e.g., 3xFLAG-twin Strep tag)

    • Place under control of a strong promoter (P*flaB1B2)

    • Include selectable marker

  • Transform using the same heat shock method

  • Verify by PCR, Western blotting, and mass spectrometry

The genetic system for M. jannaschii allows for approximately 10⁴ mevinolin-resistant colonies per μg of plasmid DNA, with a transformation efficiency about half that amount when using the DSMZ strain directly .

What unique insights can studies of MJ1417.1 provide about archaeal membrane proteins?

As a potential membrane protein based on sequence analysis, MJ1417.1 presents an opportunity to study archaeal membrane biology under extreme conditions. Research on this protein could provide insights into:

Archaeal membrane adaptations:

  • Archaeal membranes contain unique ether-linked lipids rather than ester-linked lipids found in bacteria and eukaryotes

  • These lipids contribute to membrane stability at high temperatures and pressures

  • Understanding how membrane proteins like MJ1417.1 function in this environment can reveal adaptations to extreme conditions

Evolutionary implications:

  • Comparative analysis with bacterial and eukaryotic membrane proteins can illuminate protein evolution across domains of life

  • May reveal fundamental principles of protein stability in membrane environments

  • Could identify conserved functional motifs that predate the divergence of the three domains of life

Biotechnological applications:

  • Thermostable membrane proteins have potential applications in biotechnology and nanotechnology

  • Understanding stability mechanisms can inform the design of robust membrane proteins for industrial applications

  • May yield insights for engineering membrane proteins with enhanced stability

Investigations into uncharacterized proteins like MJ1417.1 are particularly valuable when they involve proteins with no clear homology to functionally characterized proteins in other organisms, as they may represent novel protein families unique to Archaea .

How can molecular dynamics simulations enhance understanding of MJ1417.1 thermostability?

Molecular dynamics (MD) simulations provide valuable insights into protein thermal stability, particularly for thermophilic proteins like MJ1417.1. Similar approaches to those used for other M. jannaschii proteins, such as adenine deaminase, can be applied :

MD simulation approach:

  • System preparation:

    • Build computational model of MJ1417.1 using homology modeling or ab initio methods

    • Solvate in explicit water using TIP3P or similar water models

    • Add counterions to neutralize the system

    • For membrane proteins, embed in appropriate lipid bilayer model

  • Simulation protocols:

    • Perform simulations at multiple temperatures (25°C, 85°C, and 100°C)

    • Run replicate simulations (typically 3-5) of 100-500 ns each

    • Use AMBER, GROMACS, or NAMD with appropriate force fields

  • Analysis methods:

    • Root mean square deviation (RMSD) to assess structural stability

    • Root mean square fluctuation (RMSF) to identify flexible regions

    • Hydrogen bond analysis to understand thermal stability mechanisms

    • Salt bridge and hydrophobic interaction analysis

    • Principal component analysis to identify correlated motions

Expected insights:

This approach has been successfully applied to other M. jannaschii proteins, such as adenine deaminase, where MD simulations revealed the critical role of a conserved cysteine (C127) in maintaining the proper active site conformation .

What are the most reliable protein quantification methods for thermostable proteins like MJ1417.1?

Thermostable proteins like MJ1417.1 can present challenges for standard protein quantification methods due to their unusual amino acid composition and conformational properties. The following methods are recommended based on protocols used for other M. jannaschii proteins:

Bradford assay:

  • Most commonly used for M. jannaschii proteins

  • Standard curve should be prepared using BSA in the same buffer

  • Relatively insensitive to detergents at low concentrations (beneficial for membrane proteins)

  • Potential interference from basic amino acids should be considered

BCA (bicinchoninic acid) assay:

  • Compatible with many detergents and denaturants

  • Less protein-to-protein variation than Bradford

  • Better for smaller proteins

  • Not compatible with reducing agents without modification

Direct spectrophotometric measurement:

  • Calculate theoretical extinction coefficient based on amino acid composition

  • Measure absorbance at 280 nm

  • Requires pure protein preparation

  • Can be affected by nucleic acid contamination

Amino acid analysis:

  • Most accurate but requires specialized equipment

  • Useful as a reference method to validate other quantification approaches

  • Particularly valuable for proteins with unusual amino acid composition

When working with thermostable proteins, it's advisable to perform quantification using at least two independent methods to ensure accuracy, as these proteins may behave differently from mesophilic standards .

What analytical techniques are most informative for characterizing thermostable proteins from extremophiles?

The unique properties of thermostable proteins from extremophiles like M. jannaschii require specialized analytical approaches:

Thermal stability assessment:

  • Differential scanning calorimetry (DSC):

    • Measures heat capacity changes during protein unfolding

    • Provides thermodynamic parameters (Tm, ΔH, ΔCp)

    • Can be performed at various pH values and buffer conditions

  • Circular dichroism (CD) spectroscopy:

    • Monitors secondary structure changes during thermal denaturation

    • Can be measured at various temperatures (25-95°C)

    • Provides information on conformational stability

  • Thermofluor/Differential scanning fluorimetry:

    • Uses fluorescent dyes (e.g., SYPRO Orange) that bind to hydrophobic regions

    • High-throughput method for stability screening

    • Useful for optimizing buffer conditions

Structural characterization:

These techniques have been successfully applied to various M. jannaschii proteins and can provide valuable insights into the structural basis of thermostability .

How can researchers design effective mutagenesis studies to investigate the functional importance of specific residues in MJ1417.1?

Systematic mutagenesis studies can provide valuable insights into structure-function relationships in uncharacterized proteins like MJ1417.1. Based on approaches used for other M. jannaschii proteins, the following methodology is recommended :

Target residue selection:

  • Conservation analysis: Identify highly conserved residues across homologs

  • Structural predictions: Target residues in predicted functional sites

  • Unusual features: Focus on residues unique to thermophilic homologs

  • Specific motifs: Identify sequence motifs that might indicate function

Mutagenesis approaches:

  • Alanine scanning: Replace targeted residues with alanine to remove side chain interactions

  • Conservative substitutions: Replace with similar amino acids to test specific properties

  • Non-conservative substitutions: Test the effect of dramatically altering properties

  • Domain swapping: Exchange domains with characterized homologs

Expression and analysis strategy:

  • Generate mutants using site-directed mutagenesis on expression plasmids

  • Express wild-type and mutant proteins in parallel under identical conditions

  • Purify using identical protocols to minimize variation

  • Perform side-by-side comparative analyses:

    • Thermal stability (DSC, CD, or thermofluor)

    • Activity assays if function is known or predicted

    • Structural analysis (CD, fluorescence, or crystallography)

    • Binding studies if relevant

This approach was successfully applied to investigate the role of a conserved cysteine (C127) in M. jannaschii adenine deaminase, where mutation to serine completely abolished activity while mutation to alanine caused a 10-fold decrease in kcat, providing insights into the structural role of this residue .

How can computational approaches identify potential substrates or binding partners for MJ1417.1?

For uncharacterized proteins like MJ1417.1, computational methods can provide valuable insights into potential substrates or binding partners:

Virtual screening approaches:

  • Structure-based virtual screening:

    • Generate a 3D model of MJ1417.1 using homology modeling or AlphaFold2

    • Identify potential binding pockets using tools like CASTp or SiteMap

    • Perform molecular docking of compound libraries against these sites

    • Prioritize compounds based on docking scores and interaction patterns

    • Consider using specialized libraries for archaeal metabolism

  • Ligand-based screening:

    • If homologous proteins with known ligands exist, use them as templates

    • Perform pharmacophore modeling and similarity searches

    • Consider physicochemical properties important for thermostable binding (ionic interactions, hydrophobic contacts)

Network-based approaches:

  • Metabolic modeling:

    • Context within M. jannaschii's metabolic network

    • Identify "missing links" in metabolic pathways where MJ1417.1 might function

    • Use tools like KEGG or BioCyc to analyze pathway gaps

  • Co-expression analysis:

    • Analyze transcriptomic data if available

    • Identify genes with similar expression patterns

    • Cluster analysis to identify functionally related groups

  • Phylogenetic profiling:

    • Identify proteins with similar phylogenetic distributions

    • Suggests functional relationships or involvement in the same pathway

These computational predictions should be experimentally validated using binding assays, activity screens, or structural studies to confirm the actual function of MJ1417.1 .

What bioinformatic approaches can help place MJ1417.1 in the broader context of archaeal evolution?

Understanding the evolutionary context of MJ1417.1 can provide important clues about its function and importance. The following bioinformatic approaches are recommended:

Comprehensive phylogenetic analysis:

  • Homolog identification:

    • Perform sensitive sequence searches using PSI-BLAST, HHpred, or MMseqs2

    • Search archaeal, bacterial, and eukaryotic databases separately

    • Include metagenome-derived sequences to capture uncultured diversity

  • Multiple sequence alignment:

    • Use alignment tools optimized for divergent sequences (MAFFT, T-Coffee)

    • Manually refine alignments focusing on conserved motifs

    • Consider structure-guided alignments if homologous structures exist

  • Phylogenetic tree construction:

    • Use maximum likelihood (RAxML, IQ-TREE) or Bayesian (MrBayes) methods

    • Apply appropriate substitution models

    • Perform bootstrap analysis or posterior probability calculation

Comparative genomics approaches:

  • Gene neighborhood analysis:

    • Examine conservation of genomic context across archaea

    • Identify co-occurring genes that might indicate functional relationships

  • Domain architecture analysis:

    • Compare domain arrangements with homologs

    • Identify domain fusion events that might indicate functional links

  • Horizontal gene transfer analysis:

    • Identify potential HGT events

    • Compare with phylogenetic distribution of related genes

These analyses can help determine whether MJ1417.1 represents an ancient protein family present in the last universal common ancestor (LUCA) or a more recent archaeal innovation, providing context for functional studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.