Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1433 (MJ1433)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, specific format requests should be noted during order placement to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is defined during production. If a specific tag type is required, please specify this during your order; we will prioritize development accordingly.
Synonyms
MJ1433; Uncharacterized protein MJ1433
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1433
Target Protein Sequence
MNDKRYMLIIAICLIFLSILVYSIHFLIFGKVDYILSYFLLHLAFVPIEVLLVSLIIEKI LDYREKKKILEKLNMVVGSFFNSVGEELLKIILEGDVGNIRDYLKISDEWNDKTYEETKK LLMNYDCNIDIEKIDLYKLKNLLERNKEFLLRLMENPLLLEHESFTELLLAVFHLADELH RREDLSNLPKSDLDHLKNDIIRVYKLLIIQWLNYLMHLKDNYPYLYSLCLRANPFDNKSI IIEEDDK
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1433

STRING: 243232.MJ_1433

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of MJ1433 within Methanocaldococcus jannaschii?

MJ1433 is a protein-coding gene located within the 1.66-megabase pair genome of Methanocaldococcus jannaschii. This autotrophic archaeon was originally isolated from a deep-sea "white smoker" chimney at a depth of 2600m on the East Pacific Rise . The gene is part of the main chromosome rather than either of the two extrachromosomal elements (58kb and 16kb) that comprise the full M. jannaschii genome .

To study the genomic context:

  • Utilize whole-genome sequence data (GenBank accession provided in SEQ ID NO:1)

  • Analyze upstream and downstream sequences to identify potential operons or regulatory elements

  • Examine the G+C content (31.4% for the main chromosome) to identify potential horizontal gene transfer events

  • Compare synteny across related archaeal species to evaluate evolutionary conservation

What is known about the structural characteristics of the MJ1433 protein?

The MJ1433 protein consists of 247 amino acids as identified in the complete genome sequence of M. jannaschii . A computed structure model is available in the RCSB Protein Data Bank (PDB ID: AF_AFQ58828F1) . The model was generated using AlphaFold and released in 2021, with the last modification in September 2022 .

The structural confidence metrics indicate:

To further analyze the structure:

  • Compare the AlphaFold model with similar structures in the PDB

  • Utilize secondary structure prediction methods to identify potential functional motifs

  • Apply molecular dynamics simulations to assess structural stability at the high temperatures (85°C optimal) that M. jannaschii inhabits

How can recombinant MJ1433 protein be efficiently expressed and purified?

Based on available commercial protocols, recombinant MJ1433 protein can be efficiently expressed using the following methodology:

  • Expression system selection:

    • E. coli has been successfully used as a host for MJ1433 expression

    • Use vectors that incorporate an N-terminal His-tag for purification purposes

    • Consider codon optimization for the E. coli expression system

  • Protein expression protocol:

    • Transform the expression construct into an appropriate E. coli strain

    • Culture in suitable medium with appropriate antibiotics

    • Induce expression (typically with IPTG for T7-based systems)

    • Harvest cells by centrifugation

    • Lyse cells using appropriate buffer systems considering the thermophilic nature of the original protein

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

    • Consider heat treatment (65-70°C) as a purification step, taking advantage of the thermostable nature of archaeal proteins

    • Further purify using size exclusion chromatography if needed

    • Dialyze against appropriate storage buffer

  • Quality assessment:

    • SDS-PAGE to verify size and purity (>90% purity is achievable)

    • Western blot using anti-His antibodies

    • Mass spectrometry to confirm protein identity

Reagent/ConditionSpecificationNotes
Expression HostE. coliDemonstrated successful expression
Protein Length247 amino acids (Full Length)Full sequence verified
TagN-terminal His-tagFacilitates purification
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0Maintains stability
Storage Recommendation-20°C/-80°C with 50% glycerolAvoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Add glycerol for long-term storage

What analytical methods are appropriate for characterizing recombinant MJ1433?

For comprehensive characterization of recombinant MJ1433, employ the following analytical methods:

  • Physical characterization:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure elements

    • Differential scanning calorimetry (DSC) to determine thermal stability, particularly relevant for a protein from a thermophilic organism

    • Dynamic light scattering (DLS) to assess homogeneity and potential oligomerization states

  • Functional analysis:

    • Activity assays based on computational predictions of potential functions

    • Ligand binding studies using isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR)

    • Structural analysis through X-ray crystallography or cryo-electron microscopy

  • Comparative analysis:

    • Homology modeling and structural comparisons with functionally characterized proteins

    • Conservation analysis across archaeal species

    • Analysis of genomic context for potential functional associations

  • Biophysical characterization:

    • Thermal shift assays to identify stabilizing conditions

    • Protein-protein interaction studies using pull-down assays with archaeal lysates

    • Mass spectrometry to identify potential post-translational modifications

What computational approaches can predict potential functions of MJ1433?

As an uncharacterized protein, MJ1433 requires integrated computational approaches to predict its potential functions:

  • Sequence-based analysis:

    • PSI-BLAST searches against non-redundant protein databases

    • Hidden Markov Model (HMM) profile searches against specialized databases like Pfam

    • Analysis of conserved domains and motifs using PROSITE, InterPro, and CDD

  • Structure-based predictions:

    • Structural alignment with functionally characterized proteins using DALI or TM-align

    • Binding site prediction using CASTp, SiteMap, or FTMap

    • Analysis of surface electrostatics and hydrophobicity to identify potential functional sites

  • Genomic context analysis:

    • Gene neighborhood analysis across archaeal species

    • Co-expression data in related organisms

    • Phylogenetic profiling to identify proteins with similar evolutionary patterns

  • Integrated approaches:

    • Machine learning algorithms trained on multiple features

    • Molecular dynamics simulations to identify potential binding sites

    • Virtual screening for potential ligands based on predicted binding sites

These computational predictions should guide the design of experimental validation studies, including targeted mutagenesis of predicted functional residues and biochemical assays.

How can experimental approaches be designed to elucidate the physiological role of MJ1433?

To determine the physiological role of MJ1433, a multi-faceted experimental approach is recommended:

  • Gene deletion or silencing studies:

    • Develop a CRISPR-Cas9 system optimized for M. jannaschii or a closely related model archaeon

    • Create knockout strains and analyze phenotypic changes under various growth conditions

    • Perform complementation studies to confirm the specificity of observed phenotypes

  • Protein-protein interaction studies:

    • Conduct pull-down assays using His-tagged MJ1433 as bait against M. jannaschii lysates

    • Perform yeast two-hybrid screening or bacterial two-hybrid screening with an archaeal genomic library

    • Validate interactions using biolayer interferometry or co-immunoprecipitation

  • Localization studies:

    • Generate antibodies against purified MJ1433 for immunolocalization

    • Create GFP fusion constructs for live-cell imaging in model systems

    • Perform subcellular fractionation followed by Western blotting

  • Transcriptomic and proteomic analysis:

    • Compare wild-type and MJ1433 mutant strains under various growth conditions

    • Identify genes and proteins with altered expression patterns

    • Integrate with metabolomic data to identify affected pathways

  • Environmental response analysis:

    • Test growth under various stressors (temperature extremes, pressure, pH, nutrient limitation)

    • Analyze changes in MJ1433 expression levels under different conditions

    • Investigate post-translational modifications in response to environmental changes

Experimental ApproachTechnical RequirementsExpected Outcomes
Gene KnockoutCRISPR-Cas9 system for archaeaPhenotypic changes indicating function
Protein InteractionsPull-down assays, MS analysisIdentification of interaction partners
LocalizationImmunolocalization, cell fractionationSubcellular location insights
TranscriptomicsRNA-seq, data analysis pipelineGene expression changes
Environmental ResponseControlled growth chambersStress response profile

What challenges exist in structural studies of MJ1433 and how can they be addressed?

Structural characterization of MJ1433 presents several challenges that require specialized approaches:

  • Crystallization challenges:

    • Thermophilic proteins often have flexible surface loops that impede crystallization

    • Solution: Surface entropy reduction (SER) by mutating flexible surface residues to alanine

    • Alternative approach: Use truncation constructs based on domain predictions

    • Consider inclusion of potential binding partners or ligands to stabilize the structure

  • NMR spectroscopy considerations:

    • Size limitations (MJ1433 at 247 amino acids may be challenging)

    • Solution: Use selective isotope labeling strategies (15N, 13C, 2H)

    • Consider domain-by-domain structural analysis

    • Employ TROSY techniques to improve spectral quality

  • Cryo-electron microscopy approaches:

    • Challenge: Small proteins (<50 kDa) are difficult to visualize by cryo-EM

    • Solution: Utilize Fab fragments or scaffold proteins to increase apparent size

    • Alternatively, analyze MJ1433 in complex with larger interaction partners

    • Consider using apoferritin as an internal standard for improved resolution

  • Computational modeling refinement:

    • Integrate experimental data from limited proteolysis, cross-linking, and hydrogen-deuterium exchange

    • Apply molecular dynamics simulations at elevated temperatures to mimic native conditions

    • Validate predictions through targeted mutagenesis and functional assays

    • Use evolutionary coupling analysis to identify potentially interacting residues

How does the evolution of MJ1433 provide insights into archaeal adaptation to extreme environments?

Evolutionary analysis of MJ1433 can reveal important aspects of archaeal adaptation to extreme environments:

  • Phylogenetic analysis approach:

    • Construct phylogenetic trees using homologs from diverse archaeal species

    • Compare sequences from organisms living in different extreme environments

    • Identify sites under positive selection using methods like PAML

    • Correlate sequence changes with environmental parameters (temperature, pressure, pH)

  • Comparative genomics strategy:

    • Analyze gene neighborhood conservation across archaeal species

    • Identify co-evolving genes that may function in related pathways

    • Examine horizontal gene transfer patterns in genomic regions containing MJ1433

    • Compare gene absence/presence patterns across archaea with different ecological niches

  • Structural adaptation analysis:

    • Identify amino acid compositions associated with thermostability

    • Analyze salt bridge distributions and hydrophobic core packing

    • Compare flexibility/rigidity profiles across homologs from different environments

    • Correlate structural features with optimal growth conditions of source organisms

  • Experimental validation:

    • Express and purify MJ1433 homologs from different archaeal species

    • Compare thermal stability, pH tolerance, and pressure resistance

    • Perform complementation studies in different archaeal hosts

    • Engineer chimeric proteins to identify domains responsible for extreme environment adaptation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.