Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1442 (MJ1442)
Description
Introduction to Recombinant Methanocaldococcus jannaschii Uncharacterized Protein MJ1442 (MJ1442)
MJ1442 is a recombinant protein derived from Methanocaldococcus jannaschii, a hyperthermophilic methanogen isolated from deep-sea hydrothermal vents. Initially identified as an uncharacterized open reading frame (ORF) in the genome of M. jannaschii, this protein (UniProt ID: Q58837) has been recombinantly expressed and purified for research applications. Its full-length sequence spans 202 amino acids (1–202), with structural and functional studies remaining limited due to its classification as an uncharacterized protein .
Genomic Context
MJ1442 was first annotated during the complete genome sequencing of M. jannaschii in 1996, which identified 1,738 predicted protein-coding genes . It is located on the main chromosome and lacks homology to known proteins or conserved domains, as noted in the original genome analysis .
Amino Acid Sequence
The full-length protein sequence is:
MTSIRIFIKFYGGTMRKFLIFLIFLSVLGCGITISGCIGGKNVEEIQNMQEQVVQQQQNE NQEEYQNEDEGVDYNSIRDVQPIGTAKEADEKIRPILNEVFGEVKLMEYVSTGKQNEGES IVLTYVPKRKITTNDFEKLNEAIKKSGYFESSGGIAGGGQSGEGMVLWYVSKDNKSAIQI ILYPDTNEIVVGYYKGKIYSSQ .
| Property | MJ1442 |
|---|---|
| UniProt ID | Q58837 |
| Gene Name | mj1442 |
| Protein Length | 202 amino acids (Full Length) |
| Molecular Weight | Not explicitly reported |
| Isoelectric Point (pI) | Not explicitly reported |
Recombinant Production and Purification
MJ1442 is produced in Escherichia coli as a His-tagged recombinant protein for efficient purification via nickel-affinity chromatography . Key production parameters include:
| Parameter | MJ1442 |
|---|---|
| Expression Host | E. coli |
| Tag | N-terminal His-tag |
| Purity | >90% (SDS-PAGE verified) |
| Form | Lyophilized powder |
| Buffer | Tris/PBS-based, 6% trehalose, pH 8.0 |
Research Applications and Limitations
-
Structural Biology: Crystallographic or cryo-EM studies to resolve its 3D structure.
-
Functional Screens: High-throughput assays to identify substrate specificity or interaction partners.
Table 2: Genomic and Functional Context
| Property | MJ1442 |
|---|---|
| Genome Position | Main chromosome (exact coordinates not reported) |
| Homology Matches | None reported (1996–2025) |
| Predicted Function | Uncharacterized |
Product Specs
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance to arrange dry ice shipping; additional fees will apply.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Target Background
KEGG: mja:MJ_1442
STRING: 243232.MJ_1442
