Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1457 (MJ1457)

Shipped with Ice Packs
In Stock

Description

Introduction

MJ1457 is an uncharacterized protein encoded by the MJ1457 gene in Methanocaldococcus jannaschii, a hyperthermophilic archaeon isolated from deep-sea hydrothermal vents . While its native function remains unknown, recombinant versions of this protein have been produced for structural and biochemical studies. Below is a detailed analysis of its properties, production methods, and research significance.

Amino Acid Sequence and Tagging

The recombinant MJ1457 protein is a full-length construct (1–135 amino acids) with an N-terminal His-tag for purification . Its sequence includes hydrophobic regions (e.g., "MMVMTALTLLILFFGLAFILVGFGLILGYL") and polar residues, suggesting potential membrane-associated or enzymatic roles .

ParameterValueSource
UniProt IDQ58852
Host OrganismEscherichia coli
TagN-terminal His-tag
Length135 amino acids
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS with 6% trehalose, pH 8.0

Stability and Handling

  • Storage: Lyophilized powder stored at -20°C/-80°C .

  • Reconstitution: Suggested to reconstitute in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term stability .

  • Avoidance: Repeated freeze-thaw cycles are discouraged to prevent degradation .

Production and Purification

MJ1457 is heterologously expressed in E. coli using standard recombinant protein protocols . Key steps include:

  1. Cloning: Insertion of the MJ1457 gene into a plasmid vector.

  2. Induction: Overexpression under optimized growth conditions.

  3. Purification: Affinity chromatography leveraging the His-tag, followed by SDS-PAGE validation .

Genomic and Functional Annotation

M. jannaschii’s genome, sequenced in 1996, contains 1,770 protein-coding genes, with over 30% remaining uncharacterized . MJ1457 falls into this category, reflecting gaps in functional assignments for archaeal proteins . Recent reannotation efforts (MjCyc database) highlight the need for experimental validation of predicted pathways .

Metabolic Pathway Insights

While MJ1457 is not directly linked to known pathways (e.g., ribose-5-phosphate biosynthesis ), its presence in a model organism underscores the importance of studying uncharacterized proteins for understanding archaeal metabolism. For instance:

  • M. jannaschii lacks pentose phosphate pathway intermediates (e.g., erythrose-4-phosphate) but utilizes alternative routes like the ribulose monophosphate pathway .

  • Proteins like MJ1457 may participate in novel enzymatic or regulatory mechanisms yet to be discovered .

Potential Use Cases

  1. Structural Biology: Crystallography or cryo-EM studies to elucidate folding and binding interactions .

  2. Functional Screening: Enzymatic assays to test for catalytic activity (e.g., transferases, hydrolases) based on sequence motifs .

  3. Genetic Tools: Integration into M. jannaschii’s genetic system for in vivo functional studies .

Challenges

  • Annotation Limitations: Current databases (KEGG, BioCyc) lack functional data for MJ1457 .

  • Experimental Validation: Requires targeted mutagenesis or biochemical assays to confirm hypotheses .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ1457; Uncharacterized protein MJ1457
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-135
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1457
Target Protein Sequence
MMVMTALTLLILFFGLAFILVGFGLILGYLIFSRKNKTVNGTANRTVVVERDSSNLLGTA AAVAGGVIAGELITDAIEDVINNNENNEADGYNSEGIETTIEDTIEEIDKGVDNVIEDIT DEIDNITNDIGDSFF
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1457

STRING: 243232.MJ_1457

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.