Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1469.1 (MJ1469.1)

Shipped with Ice Packs
In Stock

Description

Biological Context in Methanocaldococcus jannaschii

M. jannaschii is a hyperthermophilic archaeon isolated from deep-sea hydrothermal vents, notable for its role as a model organism in archaeal biology and extreme-environment adaptation . Key genomic insights:

  • First sequenced archaeon: Its 1.66 Mb genome revealed extensive horizontal gene transfer and novel metabolic pathways .

  • Uncharacterized Proteins: Approximately one-third of its genome lacks functional annotation, including MJ1469.1 .

  • Archaeosortase Family: ArtD proteins are implicated in protein sorting and lipid modification in archaea, though MJ1469.1’s specific role remains undefined .

Biochemical Utility

  • Structural Studies: Recombinant MJ1469.1 is used to investigate archaeal protein-sorting mechanisms and thermostable enzyme engineering .

  • Model for Ancient Metabolism: As part of the MjCyc pathway-genome database, MJ1469.1 contributes to hypotheses about early Earth metabolic evolution .

Genetic Tools Development

Recent advances in M. jannaschii genetic systems (e.g., gene knockouts, affinity tagging) enable functional studies of uncharacterized proteins like MJ1469.1 . For example:

  • Homologous Overexpression: A Streptactin XT-purified M. jannaschii protein (Mj-FprA) achieved 2,100 µmol/min/mg activity at 70°C, showcasing the feasibility of thermostable protein production .

Future Research Directions

  1. Functional Characterization: Leverage CRISPR-based tools developed for M. jannaschii to elucidate MJ1469.1’s role in archaeal cell biology .

  2. Structural Resolution: Cryo-EM or X-ray crystallography could reveal its interaction partners and catalytic domains.

  3. Pathway Integration: Link MJ1469.1 to methanogenic cofactor biosynthesis or stress-response systems via the MjCyc database .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
artD; MJ1469.1; Probable archaeosortase D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1469.1
Target Protein Sequence
MGNKNAIYILRFLIYFFIFYYILKMLEGNIMDLLTITLSKLLNLKFYKNEIIVGKNIIEI SSPCTCSLEMALFLGYIFGTPDVPIKYKISYSVFGLSIITISNILRIILIINYSNMINYN VVHDVISFIIFPIALFLNWFWIYLLKMKKIIMFK
Uniprot No.

Target Background

Function

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1469.1 (MJ1469.1)

This transpeptidase recognizes and modifies its substrate through proteolytic cleavage of a sorting signal. Following cleavage, a covalent intermediate forms via a thioester bond between the archaeosortase and its substrate. This intermediate is then transferred and covalently attached to the cell membrane.

Database Links
Protein Families
Exosortase/archaeosortase family, Archaeosortase D subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MJ1469.1 and what organism does it originate from?

MJ1469.1 is an uncharacterized protein from Methanocaldococcus jannaschii, a thermophilic methanogenic archaeon first isolated from a submarine hydrothermal vent at a depth of 2600m in the East Pacific Rise. M. jannaschii is historically significant as the first archaeon to have its complete genome sequenced . The organism is classified within the domain Archaea, phylum Methanobacteriota, and family Methanocaldococcaceae .

The protein is also annotated as "Probable archaeosortase D" (artD) in some databases, suggesting a potential role in protein processing or membrane protein organization, though this function remains to be experimentally verified .

What are the optimal storage and handling conditions for recombinant MJ1469.1?

For optimal stability and activity of recombinant MJ1469.1, the following storage and handling guidelines are recommended:

Storage DurationRecommended ConditionNotes
Short-term (≤1 week)4°CFor working aliquots
Long-term-20°C or -80°CAliquoting is necessary to avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Add 5-50% glycerol for freeze stability

The protein is typically supplied in either a Tris-based buffer with 50% glycerol or a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . Repeated freezing and thawing should be strictly avoided as it can compromise protein integrity and activity .

How can researchers approach functional characterization of an uncharacterized protein like MJ1469.1?

Characterizing an uncharacterized protein like MJ1469.1 requires a multi-faceted approach combining computational, biochemical, and structural methods:

  • Bioinformatic analysis:

    • Sequence homology searches across archaeal species

    • Protein domain prediction and structural modeling

    • Phylogenetic analysis to identify functional relationships with characterized proteins

  • Structural studies:

    • X-ray crystallography, NMR spectroscopy, or cryo-EM to determine three-dimensional structure

    • Secondary structure analysis using circular dichroism spectroscopy

    • Molecular dynamics simulations to predict functional regions

  • Biochemical characterization:

    • Activity assays based on predicted archaeosortase function

    • Substrate specificity studies using synthetic peptides

    • Metal ion and cofactor dependency analysis

  • Protein-protein interaction studies:

    • Pull-down assays to identify binding partners

    • Proteomic analysis of complexes formed in vivo

    • Yeast two-hybrid or bacterial two-hybrid systems adapted for archaeal proteins

  • Genetic approaches:

    • Gene knockout or knockdown studies (if genetic tools are available for M. jannaschii)

    • Heterologous expression in model archaeal systems with phenotypic screening

What experimental approaches can investigate potential membrane association of MJ1469.1?

The amino acid sequence of MJ1469.1 suggests potential membrane association, which can be investigated through:

  • Computational prediction:

    • Transmembrane domain prediction using TMHMM, Phobius, or HMMTOP

    • Hydropathy plot analysis using Kyte-Doolittle algorithm

    • Signal peptide and membrane topology prediction

  • Biochemical methods:

    • Membrane fractionation of M. jannaschii or recombinant expression systems

    • Carbonate extraction to distinguish peripheral from integral membrane proteins

    • Phase separation using Triton X-114 to isolate hydrophobic membrane proteins

  • Microscopy and localization studies:

    • Immunolocalization with antibodies against MJ1469.1

    • Fluorescent protein fusions (considering thermostability limitations)

    • Electron microscopy with immunogold labeling

  • Biophysical approaches:

    • Liposome reconstitution experiments

    • Circular dichroism spectroscopy in the presence of membrane mimetics

    • Surface plasmon resonance with lipid bilayers

How can researchers investigate the putative archaeosortase activity of MJ1469.1?

As MJ1469.1 has been annotated as a "Probable archaeosortase D" , the following approaches can help characterize this putative enzymatic activity:

  • Substrate identification:

    • Bioinformatic prediction of proteins containing archaeosortase recognition motifs in M. jannaschii

    • Comparative proteomics between wild-type and MJ1469.1-depleted strains

    • Affinity-based substrate trapping using catalytically inactive variants

  • Activity assays:

    • Development of FRET-based peptide cleavage assays

    • Mass spectrometry to detect specific cleavage products

    • In vitro reconstitution of protein processing pathways

  • Mechanistic studies:

    • Site-directed mutagenesis of predicted catalytic residues

    • Inhibitor studies to characterize catalytic mechanism

    • Analysis of metal ion requirements typical of sortase-like enzymes

  • Structural studies focused on catalysis:

    • Co-crystallization with substrate peptides or substrate analogs

    • NMR studies of enzyme-substrate interactions

    • Molecular docking simulations

What are the key challenges in recombinant expression and purification of MJ1469.1?

Expressing and purifying proteins from extremophiles like M. jannaschii presents several challenges:

ChallengeDescriptionRecommended Solutions
Protein foldingThermophilic proteins may not fold properly at standard temperaturesUse higher expression temperatures (30-42°C); consider archaeal expression hosts; employ heat shock during induction
Codon biasCodon usage differences between M. jannaschii and expression hostsUse codon-optimized synthetic genes; select expression strains with rare tRNAs
Membrane associationPotential membrane association complicates purificationInclude detergents or membrane-mimetic systems; express with solubility-enhancing tags like His-tag
Post-translational modificationsArchaeal-specific modifications may be absent in bacterial hostsConsider archaeal expression systems when possible; validate protein functionality
Protein stabilityMaintaining stability during purificationInclude stabilizing additives like glycerol (50%) or trehalose (6%) ; maintain appropriate buffer conditions

Current expression systems have successfully produced recombinant MJ1469.1 in E. coli with N-terminal His-tags , suggesting these challenges can be overcome with appropriate optimization.

What considerations are important when designing experiments to study MJ1469.1 under native-like conditions?

M. jannaschii thrives in extreme environments (48-94°C, high pressure, moderate salinity) , necessitating specialized approaches for studying MJ1469.1 under native-like conditions:

  • Temperature considerations:

    • Use high-temperature incubators and heat-resistant equipment

    • Select thermostable buffers and reagents

    • Account for accelerated reaction rates at elevated temperatures

  • Pressure considerations:

    • Employ high-pressure bioreactors to simulate deep-sea conditions (260 atmospheres)

    • Consider specialized equipment for high-pressure biochemical assays

    • Evaluate protein structure and function under varying pressure conditions

  • Buffer and environmental considerations:

    • Use buffers that maintain pH stability at high temperatures

    • Include salts to mimic marine environment

    • Consider anaerobic conditions for functional studies

  • Experimental design adaptations:

    • Include controls at both standard and extreme conditions

    • Develop thermostable reporter systems for functional assays

    • Account for potential spontaneous chemical reactions at elevated temperatures

How should researchers approach structure-function relationship studies of MJ1469.1?

Structure-function relationship studies for MJ1469.1 require a methodical approach:

  • Initial structural characterization:

    • Secondary structure analysis using circular dichroism spectroscopy

    • Tertiary structure determination via X-ray crystallography, NMR, or cryo-EM

    • In silico modeling based on homologous archaeal proteins

  • Functional domain mapping:

    • Limited proteolysis to identify stable domains

    • Truncation analysis to identify minimal functional units

    • Conservation analysis across archaeal species

  • Site-directed mutagenesis strategy:

    • Target conserved residues identified through multiple sequence alignment

    • Focus on predicted catalytic or substrate-binding sites

    • Create systematic alanine scanning libraries for unbiased approach

  • Correlation between structure and function:

    • Analyze effects of mutations on both structural integrity and function

    • Use thermal stability assays to assess structural impact of mutations

    • Employ molecular dynamics simulations to understand conformational changes

What is the evolutionary significance of MJ1469.1 across archaeal lineages?

Understanding the evolutionary context of MJ1469.1 involves:

  • Comparative genomics:

    • Identification of homologs across different archaeal species

    • Analysis of gene conservation, particularly among extremophiles

    • Examination of genomic context and gene neighborhoods

  • Phylogenetic analysis:

    • Construction of phylogenetic trees to trace evolutionary history

    • Identification of conserved domains and sequence motifs

    • Detection of signatures of selection that might indicate functional importance

  • Structural evolution:

    • Analysis of adaptation signatures in protein structure

    • Comparison of thermophilic adaptations across homologs

    • Identification of structurally conserved regions despite sequence divergence

  • Functional conservation:

    • Comparison of cellular roles across archaeal species

    • Analysis of specialization in different environmental niches

    • Complementation studies across species

How does MJ1469.1 research contribute to our understanding of archaeal biology?

Research on MJ1469.1 contributes to several important areas in archaeal biology:

  • Archaeal-specific cellular processes:

    • Understanding unique protein processing mechanisms

    • Characterization of archaeal membrane biogenesis

    • Insights into extremophile-specific cellular adaptations

  • Evolutionary insights:

    • Contribution to understanding archaeal phylogeny

    • Insights into evolution of protein processing systems

    • Comparison with bacterial and eukaryotic homologs

  • Biotechnological applications:

    • Development of thermostable enzymes for biotechnological applications

    • Insights into protein stability under extreme conditions

    • Potential applications in synthetic biology

  • Fundamental archaeal biology:

    • Contribution to completing the functional annotation of the M. jannaschii genome

    • Understanding of archaeal-specific adaptations

    • Comparative analysis with other extremophiles

What technological advances are needed to better study proteins like MJ1469.1?

Advancing research on archaeal proteins like MJ1469.1 requires:

  • Methodological improvements:

    • Development of genetic tools for M. jannaschii and related archaea

    • Improved crystallization methods for membrane-associated archaeal proteins

    • High-pressure, high-temperature compatible biochemical assays

  • Computational advances:

    • Better prediction algorithms for archaeal protein structures

    • Improved tools for identifying distant homologs

    • Specialized functional prediction for archaeal proteins

  • High-throughput approaches:

    • Archaeal-specific protein interaction mapping technologies

    • Systems for heterologous expression screening

    • Archaeal protein activity profiling platforms

  • Interdisciplinary integration:

    • Combination of structural biology with in situ studies

    • Integration of systems biology approaches for archaeal research

    • Development of specialized equipment for extremophile protein research

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.