Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1470 (MJ1470)

Shipped with Ice Packs
In Stock

Description

Methanocaldococcus jannaschii as a Model Hyperthermophile

Methanocaldococcus jannaschii is a hyperthermophilic methanogenic archaeon initially isolated from a hydrothermal vent environment. This organism has attracted significant scientific interest due to its ability to thrive in extreme conditions, including high temperatures and pressures. M. jannaschii was one of the first archaeal genomes to be fully sequenced, revealing numerous proteins with unknown functions that could potentially offer insights into molecular adaptations for extreme environments.

The organism, formerly known as Methanococcus jannaschii, has been reclassified as Methanocaldococcus jannaschii, reflecting its extreme thermophilic nature. It is maintained in culture collections under various designations including ATCC 43067, DSM 2661, JAL-1, JCM 10045, and NBRC 100440, which facilitates standardized research across different laboratories . M. jannaschii serves as an excellent model organism for studying archaeal biology and proteins that function under extreme conditions.

Overview of Uncharacterized Protein MJ1470

MJ1470 is a protein encoded by the MJ1470 gene in the M. jannaschii genome. It is classified as an "uncharacterized protein," meaning that its precise biological function remains to be fully elucidated through experimental validation. The protein consists of 624 amino acids and has been assigned the UniProtKB accession number Q58865 . Despite its uncharacterized status, the availability of its complete amino acid sequence has enabled the production of recombinant versions of this protein for research purposes.

The term "uncharacterized" indicates that while the protein's existence is confirmed through genomic data and expression studies, its biological role, enzymatic activities (if any), interaction partners, and participation in cellular pathways remain largely unknown. This classification is common for many proteins identified through genome sequencing projects, particularly from non-model organisms like M. jannaschii.

Expression Systems and Production Methods

Recombinant MJ1470 protein has been successfully expressed in Escherichia coli expression systems . This approach leverages the well-established bacterial expression machinery to produce archaeal proteins for research purposes. The recombinant protein is engineered to include an N-terminal histidine (His) tag, which facilitates purification using affinity chromatography techniques .

The full-length protein (amino acids 1-624) is expressed, preserving the complete native sequence while adding the His tag for purification purposes . This approach allows researchers to study the entire protein rather than just functional domains or fragments, potentially providing more comprehensive insights into its structure and function.

Purification and Quality Assessment

The recombinant MJ1470 protein is purified to a high level of homogeneity, with purity greater than 90% as determined by SDS-PAGE analysis . This level of purity is essential for reliable results in subsequent biochemical and structural studies. The protein is ultimately prepared as a lyophilized powder, which enhances stability during storage and shipping .

The purification process likely involves immobilized metal affinity chromatography (IMAC) targeting the His tag, followed by additional chromatographic steps to achieve the high level of purity reported. Quality control procedures, including SDS-PAGE and possibly mass spectrometry, ensure that the final product meets the required specifications for research applications.

Molecular Weight and Size

The size of the protein, spanning 624 amino acids, places it in the medium-to-large category of proteins. Proteins of this size often exhibit complex tertiary structures with multiple domains that can function independently or cooperatively. The substantial size of MJ1470 suggests it may have multiple functional domains or interaction surfaces.

Reconstitution of Lyophilized Protein

The recombinant MJ1470 protein is supplied as a lyophilized powder, requiring reconstitution before use in laboratory experiments. The recommended reconstitution protocol involves brief centrifugation of the vial to bring contents to the bottom, followed by addition of deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL . This concentration range is suitable for most biochemical assays and structural studies.

After reconstitution, the addition of glycerol to a final concentration of 5-50% is recommended to enhance stability for long-term storage . The default recommendation of 50% glycerol provides maximum protection against freeze-thaw damage but may require consideration in experimental designs where high glycerol concentrations could interfere with specific assays or applications.

Stability Considerations for Laboratory Use

To maintain the integrity of recombinant MJ1470 protein during laboratory use, repeated freeze-thaw cycles should be avoided . Instead, the preparation of working aliquots that can be stored at 4°C for up to one week is recommended. This approach minimizes protein degradation while providing convenient access for ongoing experiments.

The protein appears to be stable in Tris/PBS-based buffer at pH 8.0, which should be considered when designing experiments that might require different buffer conditions. Any significant deviation from the recommended storage conditions should be validated to ensure the protein maintains its native conformation and any associated activities.

Relationship to DEAD Box Proteins

While the specific function of MJ1470 remains uncharacterized, some context can be derived from the search results. The protein is mentioned in connection with DEAD box proteins from M. jannaschii , suggesting potential functional or structural relationships. DEAD box proteins constitute a family of RNA helicases that play crucial roles in virtually all aspects of RNA metabolism, including transcription, splicing, ribosome biogenesis, translation, and RNA decay.

DEAD box proteins from hyperthermophiles like M. jannaschii are of particular interest due to their extreme thermostability and potential unique adaptations for functioning at high temperatures. These proteins typically contain characteristic sequence motifs, including the eponymous D-E-A-D (Asp-Glu-Ala-Asp) sequence, which is part of a larger motif involved in ATP binding and hydrolysis.

If MJ1470 is indeed related to DEAD box proteins, it might function as an RNA helicase, utilizing the energy from ATP hydrolysis to unwind RNA secondary structures or to remodel ribonucleoprotein complexes. Such activities would be essential for numerous cellular processes in M. jannaschii, particularly those involving RNA structure modulation at high temperatures.

Research Applications and Experimental Considerations

The uncharacterized nature of MJ1470 presents both challenges and opportunities for research. As a protein from a hyperthermophilic archaeon, it may possess unique biochemical properties and thermostability that could be valuable for both basic research and biotechnological applications.

Potential research applications include:

  1. Structural studies to determine the three-dimensional architecture and potential functional domains

  2. Biochemical assays to identify potential enzymatic activities, particularly those related to RNA metabolism if the protein is indeed related to DEAD box helicases

  3. Protein-protein interaction studies to identify binding partners and potential involvement in molecular complexes

  4. Comparative studies with homologous proteins from other organisms to gain evolutionary insights

  5. Investigation of thermostability mechanisms that allow the protein to function at the extreme temperatures encountered by M. jannaschii

When working with recombinant MJ1470, researchers should consider its hyperthermophilic origin. Experimental conditions, including temperature, pH, and salt concentration, may need to be adjusted from standard protocols to better mimic the native environment of the protein or to optimize its activity for specific assays.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. If you have a specific format preference, please indicate it during order placement. We will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. To maintain optimal quality, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point for your specific needs.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
MJ1470; Uncharacterized protein MJ1470
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-624
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1470
Target Protein Sequence
MFRKIVSKRGYIFTYEAIVIAFIFLSVFYIGYMVYSHNMLTALEEKKDTEKFHKALLLKD YFLRNNKFPGKFYNKTYLDNFTNELDIKEKTFDLFNNFSEYKGLIRFIIYPNIYDEELDN ISDEICANDGLQAITYNFSSNTFKIYSNVNTTFNNANLSISGMDLIYFKENVYIPKITGM KYGDSINLYGCNGDHIYFKVNSEIISASARVVTNNGNPFITWQNWRYATPILIINNLNQN LNDYDVKIVFDSQSYINSGEMRTDCGDVRFVDEDGNPLSYWIEPNTIDTPHTVAWVKVNL APNEHKLIYMLYGNPTATTTANGDNTFPLFFDDFSKGNLDNTKWTYNFNNPLFVNDTYPN GINFTYLSLDYTYYNNHNYIIYDINNTHISSISTYYPNTSVRFHANFHKKYEEWGGFYIN INGNDYNREVITNYHWGGEWLRAESSVLNQDYDSYIILQDPDLYDNWHTYEIQRDGGSSV NFIIDDAIYKTIYSNIYTGDLPISFYARKYDYSTKYGYYPVPQDEQNGNISIDWVFVRKY VEPEPTVTLLSSDVIFTVNGYIYKKPLKSVFDNIDITPNLNVGINEIRILSSPLPVEFLI KTNENTDFYYLTLSPNNVTIVVKP
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1470

STRING: 243232.MJ_1470

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is protein MJ1470 significant for research?

Methanocaldococcus jannaschii is an autotrophic archaeon originally isolated from a deep-sea "white smoker" chimney at 2600m depth on the East Pacific Rise. This extremophile grows at pressures up to 500 atmospheres and temperatures between 48-94°C, with optimal growth around 85°C . As a strict anaerobe that produces methane, it represents an important model organism for studying archaeal biology and adaptations to extreme environments .

The uncharacterized protein MJ1470 is encoded within the 1.66-megabase pair genome of M. jannaschii . Its significance stems from several factors:

  • It represents one of the 1738 predicted protein-coding genes identified in the M. jannaschii genome sequence

  • As an uncharacterized protein, it offers valuable research opportunities for novel function discovery

  • Studying MJ1470 contributes to our understanding of archaeal molecular biology and evolution

  • Proteins from extremophiles often possess unique properties with potential biotechnological applications

The genome sequencing of M. jannaschii was a landmark achievement in archaeal genomics, providing crucial data for constructing evolutionary frameworks that help assess the molecular basis for the origin and diversification of cellular life .

What expression systems are recommended for recombinant production of MJ1470?

Based on available research data, the following expression systems have proven effective for MJ1470 production:

Expression HostVector SystemTagExpected YieldSpecial Considerations
E. colipET-basedHis-tagModerateOptimal for structural studies
E. colipGEX-basedGST-tagVariableImproved solubility possible
E. colipMAL-basedMBP-tagHigherRecommended for difficult-to-express proteins

The most documented approach utilizes E. coli as an expression host with a His-tag system for affinity purification . When designing your expression strategy, consider:

  • Codon optimization may be necessary due to the significant GC content differences between archaeal and bacterial genomes

  • Growth temperature adjustments to address protein folding challenges

  • Testing multiple fusion tags if initial expression attempts yield insoluble protein

  • Incorporating molecular chaperones to assist proper folding of this extremophile protein

What basic characterization methods should be employed for initial analysis of purified MJ1470?

Initial characterization of purified MJ1470 should follow a systematic approach:

  • Purity Assessment:

    • SDS-PAGE analysis with Coomassie staining

    • Western blotting using anti-His antibodies (if His-tagged)

    • Size exclusion chromatography to evaluate homogeneity

  • Structural Integrity Evaluation:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Thermal shift assays to determine stability profiles across temperature ranges

    • Dynamic light scattering (DLS) to verify monodispersity and oligomeric state

  • Fundamental Biochemical Properties:

    • Isoelectric point determination

    • pH stability profiling

    • Thermostability analysis (particularly important for proteins from thermophiles)

  • Preliminary Activity Screening:

    • Generic enzymatic activity assays (hydrolase, oxidoreductase, transferase activities)

    • Metal-binding assays using ICP-MS or similar techniques

    • Nucleic acid binding assessment through electrophoretic mobility shift assays

When conducting these initial analyses, it's essential to consider the thermophilic origin of the protein and perform experiments under conditions that may reflect its native environment (higher temperatures, appropriate buffer systems).

What experimental design approaches are most appropriate for functional characterization of uncharacterized proteins like MJ1470?

Functional characterization of uncharacterized proteins requires well-designed experimental approaches that follow rigorous scientific methodology. Experimental design is often considered the "gold standard" of research methodologies, particularly when establishing causal relationships between protein function and observed outcomes .

A systematic experimental design for MJ1470 functional characterization should include:

  • Hypothesis Formulation Based on Bioinformatic Analysis:

    • Develop testable hypotheses regarding function based on sequence homology, structural prediction, and genomic context

    • Establish clear causal relationships to test (If MJ1470 has function X, then outcome Y will be observed)

  • Controlled Variable Experiments:

    • Design experiments that systematically address both propositions: "If X, then Y" and "If not X, then not Y"

    • Implement proper controls including MJ1470 mutants, related characterized proteins, and appropriate negative controls

  • Validation Through Multiple Methodologies:

    • Apply orthogonal techniques to confirm findings (e.g., in vitro biochemical assays, cell-based functional assays, structural studies)

    • Use statistical approaches to assess significance of results

  • Comparative Analysis:

    • Compare MJ1470 with characterized homologs from other species when available

    • Assess conservation of key residues and their correlation with functional properties

When designing these experiments, researchers should ensure strong internal validity by minimizing confounding variables and implementing appropriate controls . This is particularly important when working with uncharacterized proteins where unexpected functions may be discovered.

How can researchers identify potential interaction partners of MJ1470?

Identifying protein interaction partners is crucial for understanding the biological context and function of uncharacterized proteins like MJ1470. Several complementary approaches are recommended:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged MJ1470 in a suitable host system

    • Perform pull-down experiments under varying conditions (temperature, salt, pH)

    • Identify co-purifying proteins by mass spectrometry

    • Implement statistical filtering to distinguish true interactors from background

  • Yeast Two-Hybrid (Y2H) Screening:

    • Construct appropriate bait plasmids containing MJ1470

    • Screen against M. jannaschii genomic library or directed candidates

    • Validate interactions through secondary screens

  • Proximity-Based Labeling Methods:

    • Fuse MJ1470 to enzymes like BioID or APEX2

    • Express in appropriate systems and allow proximity-dependent labeling

    • Identify labeled proteins through streptavidin pull-down and mass spectrometry

  • Computational Prediction and Validation:

    • Use interactome databases and prediction algorithms

    • Apply co-expression, co-evolution, and genomic context analyses

    • Validate high-confidence predictions experimentally

As noted in the available research data, the interaction network for MJ1470 has been investigated but requires further characterization . When designing interaction studies, researchers should consider the extremophilic nature of M. jannaschii and adjust experimental conditions accordingly (e.g., higher temperature, specialized buffers).

What approaches should be used to investigate potential enzymatic activities of MJ1470?

Investigating enzymatic activities of uncharacterized proteins requires a systematic approach combining computational prediction with biochemical validation:

  • Computational Prediction:

    • Analyze sequence for conserved motifs associated with enzymatic functions

    • Perform structural modeling to identify potential active sites

    • Use tools like COFACTOR, EnzymeMiner, and EFICAz for enzyme function inference

  • Activity Screening Panels:

    • Design a screening matrix with various substrates and reaction conditions

    • Include class-specific enzyme substrates based on preliminary predictions

    • Implement high-throughput colorimetric or fluorescent detection methods

  • Targeted Biochemical Assays:

    • Based on screening results, develop specific quantitative assays

    • Determine enzyme kinetics under varying conditions (temperature, pH, ionic strength)

    • Characterize substrate specificity using structurally related compounds

  • Structure-Function Analysis:

    • Generate site-directed mutants of predicted catalytic residues

    • Assess impact on activity to confirm mechanistic hypotheses

    • Perform structural studies (X-ray crystallography, cryo-EM) with substrates/inhibitors

When designing these experiments, implement proper controls including heat-denatured enzyme, catalytic site mutants, and buffer-only reactions. Given that M. jannaschii is a thermophile, enzymatic assays should be conducted at elevated temperatures (50-85°C) to capture activity under near-native conditions .

What special precautions are needed when working with proteins from hyperthermophilic archaea?

Working with proteins from hyperthermophilic archaea like M. jannaschii presents unique challenges that require specialized methodological approaches:

  • Temperature Considerations:

    • Maintain appropriate temperature conditions during expression and purification

    • Recognize that optimal activity may occur at temperatures much higher than laboratory standard (M. jannaschii grows optimally at ~85°C)

    • Design equipment setups that can safely accommodate high-temperature experiments

  • Buffer and Stability Optimizations:

    • Utilize buffers with higher pKa temperature coefficients (e.g., HEPES, Phosphate)

    • Test protein stability in the presence of osmolytes and stabilizing agents

    • Consider higher salt concentrations to mimic native conditions

  • Enzyme Activity Assessment:

    • Standard enzyme assays may require modification for high-temperature compatibility

    • Substrate stability must be verified at elevated temperatures

    • Control reactions should address spontaneous chemical reactions that may occur at high temperatures

  • Structural Studies Adaptations:

    • Perform comparative studies at both mesophilic and thermophilic temperatures

    • Consider specialized equipment for structural biology at elevated temperatures

    • Interpret structural data in the context of thermostability mechanisms

When designing experiments with MJ1470, researchers should consider that proteins from hyperthermophiles often exhibit minimal activity at standard laboratory temperatures (20-37°C) but show optimal functionality at much higher temperatures. This temperature-dependent behavior must be incorporated into experimental design and interpretation.

How should researchers approach structure-function relationship studies for MJ1470?

Structure-function relationship studies for uncharacterized proteins like MJ1470 require an integrated approach:

  • Computational Structure Prediction:

    • Utilize homology modeling if suitable templates exist

    • Apply ab initio modeling approaches for unique structural elements

    • Predict functional sites using tools like ConSurf, 3DLigandSite, and COACH

  • Experimental Structure Determination Strategy:

    • Assess protein stability and homogeneity through thermal shift assays and size exclusion chromatography

    • Perform limited proteolysis to identify stable domains for crystallization

    • Consider both X-ray crystallography and cryo-EM approaches

  • Domain Analysis and Construct Design:

    • Generate truncation constructs based on predicted domain boundaries

    • Express and characterize individual domains

    • Assess if function resides in specific domains or requires full-length protein

  • Mutagenesis Framework:

    • Design alanine-scanning or site-directed mutagenesis of predicted functional sites

    • Create a systematic mutation panel targeting conserved residues

    • Implement activity assays to correlate structural features with function

  • Structural Analysis Under Native-like Conditions:

    • Consider small-angle X-ray scattering (SAXS) at elevated temperatures

    • Utilize hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe dynamics

    • Implement molecular dynamics simulations at thermophilic temperatures

This methodological framework provides a systematic approach to unraveling the structure-function relationship of MJ1470, which is particularly important for uncharacterized proteins where function cannot be readily inferred from sequence alone.

How can researchers resolve contradictory results when characterizing uncharacterized proteins like MJ1470?

Contradictory results are common when studying uncharacterized proteins. A systematic approach to resolving these contradictions includes:

  • Methodological Reconciliation:

    • Compare experimental conditions across contradictory studies

    • Assess differences in protein constructs, tags, and expression systems

    • Evaluate buffer compositions, temperature, and other environmental factors

  • Statistical Analysis Framework:

    • Implement appropriate statistical methods based on experimental design

    • Use descriptive statistics to summarize data by experimental conditions

    • Apply techniques like Kaplan-Meier estimation for time-dependent processes when relevant

  • Orthogonal Validation Approach:

    • Confirm findings using multiple independent techniques

    • Design experiments that directly address the specific contradiction

    • Implement controls that can distinguish between competing hypotheses

  • Reconciliation Matrix:

Contradiction TypeInvestigation ApproachAnalysis MethodResolution Strategy
Activity discrepanciesVary assay conditions systematicallyComparative kinetic analysisIdentify condition-dependent behavior
Structural inconsistenciesMultiple structural methodsEnsemble analysisCharacterize conformational heterogeneity
Interaction partner differencesVary interaction detection methodsNetwork analysis with confidence scoringDefine core vs. context-dependent interactome
Expression effectsTest multiple expression systemsMultivariate analysisIdentify system-specific artifacts

When contradictions arise, researchers should consider that biological reality may be more complex than either contradictory result suggests. Apparent contradictions often lead to deeper insights when properly investigated with rigorous experimental design .

What bioinformatic approaches should be used to predict the potential function of MJ1470?

Comprehensive bioinformatic analysis of MJ1470 should employ multiple complementary approaches:

  • Sequence-Based Analysis:

    • Perform iterative sequence similarity searches (PSI-BLAST, HMMER)

    • Identify conserved domains and motifs using InterPro, PFAM, and CDD

    • Apply sensitive remote homology detection methods like HHpred

  • Structural Bioinformatics:

    • Generate structural models using AlphaFold2 or RoseTTAFold

    • Perform structural similarity searches against PDB using DALI or VAST

    • Identify potential binding pockets and functional sites

  • Genomic Context Analysis:

    • Examine gene neighborhood conservation across related species

    • Identify operonic structures or consistent gene clusters

    • Apply phylogenetic profiling to identify co-evolving genes

  • Integrative Functional Prediction:

    • Combine multiple lines of evidence using tools like STRING and FunCoup

    • Apply machine learning approaches to integrate diverse data types

    • Utilize archaeal-specific functional databases when available

  • Evolutionary Analysis:

    • Construct phylogenetic trees of MJ1470 homologs

    • Identify patterns of selective pressure using dN/dS analysis

    • Map conservation onto structural models to highlight functional constraints

The M. jannaschii genome contains numerous uncharacterized ORFs, as noted in the patent documentation . When applying bioinformatic approaches to MJ1470, researchers should recognize the limitations of transferring functional annotations from bacterial or eukaryotic proteins to archaeal proteins, given the evolutionary distance between these domains.

What emerging technologies show promise for characterizing proteins like MJ1470?

Several cutting-edge technologies offer new approaches for investigating uncharacterized proteins:

  • Cryo-Electron Microscopy Advances:

    • Single-particle analysis for high-resolution structure determination

    • Time-resolved cryo-EM to capture conformational states

    • Cryo-electron tomography for cellular context visualization

  • Integrative Structural Biology:

    • Combining multiple structural techniques (X-ray, NMR, cryo-EM, SAXS)

    • Integrative modeling platforms to synthesize diverse structural data

    • Cross-linking mass spectrometry to map interaction interfaces

  • High-Throughput Functional Screening:

    • CRISPR-based genetic screens in suitable archaeal systems

    • Activity-based protein profiling for enzyme function discovery

    • Microfluidic approaches for reaction condition optimization

  • AI and Machine Learning Applications:

    • Deep learning for function prediction from sequence/structure

    • Protein language models for functional annotation

    • Graph neural networks for analyzing protein-protein interaction networks

  • Single-Molecule Techniques:

    • FRET-based approaches to study conformational dynamics

    • Optical tweezers to investigate mechanical properties

    • Single-molecule enzymology to detect heterogeneous catalytic behaviors

These emerging technologies can provide unprecedented insights into proteins like MJ1470, potentially revealing functions and properties that traditional approaches might miss. Researchers should consider incorporating these methods into their experimental design while maintaining rigorous controls and validation strategies .

How can researchers design experiments to determine if MJ1470 has relevance to extremophile adaptation?

Investigating MJ1470's potential role in extremophile adaptation requires carefully designed experiments:

  • Comparative Genomics Framework:

    • Compare MJ1470 conservation across archaea with varying temperature optima

    • Analyze selective pressure on MJ1470 in thermophilic versus mesophilic lineages

    • Identify co-evolving genes that correlate with thermophilic adaptation

  • Stress Response Characterization:

    • Examine expression changes of MJ1470 under various stress conditions

    • Design reporter systems to monitor regulation of MJ1470 in response to temperature, pressure, and oxidative stress

    • Perform transcriptomic and proteomic analyses to position MJ1470 within stress response networks

  • Molecular Adaptation Analysis:

    • Characterize MJ1470's thermostability and biochemical properties

    • Compare properties with homologs from mesophilic organisms if available

    • Identify specific structural features that correlate with thermostability

  • Functional Impact Testing:

    • Develop genetic systems to modify MJ1470 expression in M. jannaschii

    • Assess phenotypic consequences under various temperature and pressure conditions

    • Test complementation in heterologous systems

When designing these experiments, researchers should consider that M. jannaschii is adapted to both high temperatures (optimum of 85°C) and high pressures (up to 500 atm), representing a polyextremophilic lifestyle . This complex adaptation likely involves multiple systems working in concert, requiring careful experimental design to isolate MJ1470's specific contributions.

What are the most significant challenges in studying archaeal uncharacterized proteins like MJ1470?

Researchers face several substantial challenges when investigating archaeal uncharacterized proteins:

  • Technical Challenges:

    • Limited genetic tools for archaeal systems compared to bacterial models

    • Difficulties in recreating extreme growth conditions in laboratory settings

    • Expression challenges due to codon usage differences and post-translational modifications

  • Knowledge Gaps:

    • Sparse characterization of archaeal-specific pathways and processes

    • Limited structural information on archaeal protein families

    • Evolutionary distance from well-studied model organisms complicating functional inference

  • Methodological Limitations:

    • Standard assays may not function under extremophile-relevant conditions

    • Difficulty in establishing cell-based assays for validating function

    • Challenges in observing native interactions within the archaeal cellular context

  • Unique Archaeal Biology Considerations:

    • Distinct membrane composition affecting membrane-associated processes

    • Unique central metabolism with archaeal-specific enzymes and cofactors

    • Special adaptations to extreme environments affecting protein function

Addressing these challenges requires innovative experimental approaches, development of archaeal-specific research tools, and interdisciplinary collaboration. Despite these obstacles, investigating proteins like MJ1470 offers significant potential for discovering novel biological mechanisms and functions with both fundamental and applied relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.