Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1489.1 (MJ1489.1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
MJ1489.1; Uncharacterized protein MJ1489.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1489.1
Target Protein Sequence
MLIAIGIMFQPLQYPTIPCIIFMVIVGLGLLFAFQFILGYGFEMHRQITIKDRIAFRNYV VGKIFNVLVEHSYYGLLLSTFNLFVYKKAITIRLCFIFAISIVIFWILGGKLIKKSLKLC FSWFYFFINPSISHKCNSK
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant MJ1489.1 protein?

For optimal stability and activity preservation of recombinant MJ1489.1 protein:

  • Store lyophilized powder at -20°C/-80°C (shelf life approximately 12 months)

  • For liquid preparations, store at -20°C/-80°C (shelf life approximately 6 months)

  • Avoid repeated freeze-thaw cycles as they can degrade protein quality

  • For working aliquots, store at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% is recommended as default)

  • When reconstituting, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

How should recombinant MJ1489.1 be reconstituted for experimental use?

A methodological approach to reconstitution includes:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store reconstituted aliquots at -20°C/-80°C for long-term storage

What experimental approaches should be used to determine the functional role of the uncharacterized MJ1489.1 protein?

For functional characterization of MJ1489.1, a multi-faceted approach is recommended:

  • Sequence-based analysis:

    • Perform comprehensive bioinformatic analysis comparing MJ1489.1 to characterized proteins

    • Search for conserved domains, motifs, and structural homology

    • Examine genomic context and neighboring genes in the M. jannaschii genome

  • Structural characterization:

    • Utilize X-ray crystallography or cryo-EM to determine 3D structure

    • Consider NMR for dynamic regions

    • Perform thermal stability assays (particularly relevant for proteins from hyperthermophiles)

  • Protein-protein interaction studies:

    • Perform pull-down assays using His-tagged MJ1489.1

    • Employ yeast two-hybrid or bacterial two-hybrid systems adapted for archaeal proteins

    • Use crosslinking followed by mass spectrometry to identify interaction partners

  • Physiological analysis:

    • Develop knockout/knockdown systems in model archaeal organisms

    • Express MJ1489.1 in heterologous systems under various conditions

    • Test growth phenotypes under different stress conditions

How can researchers address the challenges of expressing archaeal proteins in E. coli systems?

Expressing archaeal proteins like MJ1489.1 in E. coli poses several challenges that can be methodically addressed:

  • Codon optimization:

    • Utilize plasmids like pRI952 that contain rare tRNA genes (argU and ileX) to accommodate codons rare in E. coli but common in archaeal genomes

    • Alternatively, synthesize a codon-optimized gene sequence for E. coli expression

  • Expression conditions optimization:

    • Test multiple E. coli strains (BL21, BL21 pLysS, Rosetta, etc.)

    • Evaluate various induction temperatures (often lower temperatures improve folding)

    • Optimize IPTG concentration and induction timing

    • Consider auto-induction media for gradual protein expression

  • Solubility enhancement:

    • Test multiple fusion tags (His, GST, MBP, SUMO) for improved solubility

    • Co-express with archaeal chaperones when possible

    • Add stabilizing agents to lysis buffer (glycerol, specific salts)

  • Thermostability considerations:

    • Remember that M. jannaschii proteins are adapted to function at 85°C

    • Purification at elevated temperatures may enhance native folding

    • Include thermostability assays to verify proper folding

What methodological approaches should be used to analyze the membrane association potential of MJ1489.1?

Based on the amino acid sequence analysis, MJ1489.1 may have membrane-associated characteristics. To investigate this:

  • Computational prediction:

    • Use transmembrane prediction tools (TMHMM, Phobius, HMMTOP)

    • Analyze hydrophobicity plots

    • Identify potential lipid-binding domains

  • Experimental validation:

    • Perform membrane fractionation studies after expression

    • Use detergent solubility screens to identify optimal extraction conditions

    • Employ flotation assays to confirm membrane association

  • Structural studies:

    • Consider lipid nanodiscs for structural studies if membrane-associated

    • Use site-directed spin labeling combined with EPR for topology analysis

    • Perform cryo-EM in presence of lipids or detergent micelles

  • Functional reconstitution:

    • Create proteoliposomes to test potential transport or signaling functions

    • Develop assays for ion flux, substrate transport, or membrane dynamics

How should researchers design experiments to study MJ1489.1 function under conditions that mimic the native environment of M. jannaschii?

To accurately study MJ1489.1 function, experimental conditions should reflect M. jannaschii's extreme native environment:

  • Temperature considerations:

    • Conduct experiments at elevated temperatures (optimally around 85°C)

    • Use thermostable buffers and reaction components

    • Consider specialized equipment for high-temperature assays

  • Pressure adaptation:

    • When possible, perform assays under high pressure (up to 500 atm)

    • Use specialized high-pressure chambers for enzyme assays

    • Consider how pressure might affect protein-protein interactions

  • Anaerobic conditions:

    • Conduct experiments under strict anaerobic conditions

    • Use oxygen scavengers in buffers

    • Perform manipulations in anaerobic chambers

  • Salt concentration and pH:

    • Maintain moderate salinity in experimental buffers

    • Optimize buffer pH based on known archaeal cytoplasmic pH

    • Test salt type and concentration effects on protein activity

What are the most effective experimental controls when working with recombinant MJ1489.1 protein?

When designing experiments with MJ1489.1, the following controls are essential:

  • Negative controls:

    • Empty vector-transformed E. coli lysate processed identically

    • Heat-denatured MJ1489.1 protein

    • Buffer-only controls for all assays

  • Positive controls:

    • Well-characterized archaeal proteins with known functions

    • Other M. jannaschii proteins with established activity profiles

    • If investigating a predicted function, include known proteins with that function

  • Specificity controls:

    • Site-directed mutants of key residues

    • Truncated versions of the protein

    • Homologous proteins from related archaeal species

  • Technical validation controls:

    • Concentration-matched BSA or other inert proteins

    • Serial dilutions to demonstrate dose-dependency

    • Multiple time points to establish kinetics

How can researchers troubleshoot purification issues with recombinant MJ1489.1?

When encountering purification challenges with MJ1489.1, implement this systematic troubleshooting approach:

  • Solubility issues:

    • Adjust lysis buffer composition (try different salts, detergents, pH values)

    • Test lysis at elevated temperatures (37-60°C) to mimic native conditions

    • Consider inclusion body purification and refolding protocols

  • Purity problems:

    • Implement additional purification steps (ion exchange, size exclusion)

    • Test different imidazole concentrations in wash buffers

    • Consider on-column refolding for improved native structure

  • Stability challenges:

    • Add stabilizing agents (glycerol, trehalose, specific salts)

    • Test buffer conditions at higher temperatures

    • Monitor protein stability over time using thermal shift assays

  • Activity loss:

    • Verify proper folding using circular dichroism

    • Test activity immediately after purification

    • Include reducing agents if cysteine residues are present

What analytical techniques are most appropriate for studying protein-protein interactions involving MJ1489.1?

For investigating protein-protein interactions of MJ1489.1, consider these methodological approaches:

  • In vitro methods:

    • Pull-down assays using His-tagged MJ1489.1 and M. jannaschii lysate

    • Surface Plasmon Resonance (SPR) with immobilized MJ1489.1

    • Isothermal Titration Calorimetry (ITC) for quantitative binding parameters

    • Microscale Thermophoresis (MST) for interactions under native-like conditions

  • Cross-linking approaches:

    • Chemical cross-linking followed by mass spectrometry (XL-MS)

    • Photo-activatable amino acid incorporation for proximity labeling

    • In vivo crosslinking in heterologous expression systems

  • Biophysical techniques:

    • Analytical ultracentrifugation to determine oligomeric state

    • Native mass spectrometry for complex composition

    • FRET-based assays for interaction dynamics

  • Computational methods:

    • Molecular docking with predicted archaeal interaction partners

    • Co-evolution analysis across archaeal species

    • Protein interaction network analysis within thermophilic archaea

How should researchers design experiments to determine if MJ1489.1 has enzymatic activity?

To systematically investigate potential enzymatic functions of MJ1489.1:

  • Activity prediction:

    • Analyze sequence for catalytic motifs

    • Examine structural homology to known enzymes

    • Consider genomic context for functional clues

  • General enzyme activity screening:

    • Test hydrolase activity using general substrates (ester/amide compounds)

    • Screen for nuclease, protease, and lipase activities

    • Perform metal-dependent activity assays with various cofactors

  • Specific activity assays:

    • Design assays based on genomic context predictions

    • Test thermophile-specific biochemical pathways

    • Consider membrane-associated enzymatic functions

  • Assay optimization:

    • Perform assays at elevated temperatures (60-90°C)

    • Test pH range from 5.0 to 8.0

    • Include potential cofactors (metals, nucleotides, specific ions)

    • Ensure anaerobic conditions for activity testing

What are the best approaches for structural characterization of MJ1489.1?

For comprehensive structural characterization of MJ1489.1, implement the following methodological strategy:

  • Computational structure prediction:

    • Use AlphaFold2 or RoseTTAFold for initial structure prediction

    • Perform molecular dynamics simulations at high temperatures

    • Generate models with and without membrane environments

  • X-ray crystallography approach:

    • Screen multiple constructs (full-length, truncations)

    • Test thermophilic crystallization conditions

    • Consider lipid cubic phase crystallization if membrane-associated

    • Perform crystallization at elevated temperatures

  • NMR spectroscopy:

    • Isotopically label protein (15N, 13C) in minimal media

    • Perform experiments at elevated temperatures

    • Consider solid-state NMR if membrane-associated

  • Cryo-EM analysis:

    • Analyze oligomeric state and potential complexes

    • If membrane protein, use nanodiscs or amphipols

    • Consider high-temperature sample preparation protocols

How might MJ1489.1 contribute to our understanding of archaeal biology and evolution?

The study of MJ1489.1 offers several important insights into archaeal biology:

  • Archaeal-specific processes:

    • May reveal novel archaeal-specific biochemical pathways

    • Could provide insights into membrane biology in hyperthermophiles

    • May represent archaeal adaptations to extreme environments

  • Evolutionary significance:

    • As an uncharacterized protein, MJ1489.1 may represent a novel protein family

    • Comparative analysis with bacterial and eukaryotic homologs could reveal evolutionary relationships

    • May help establish the molecular basis for archaea as a distinct domain of life

  • Thermophilic adaptations:

    • Structural features may illustrate adaptations for protein stability at high temperatures

    • Functional characteristics could reveal thermophilic biochemical mechanisms

    • May provide insights into the evolution of thermostability

  • Biotechnological implications:

    • Potential applications in high-temperature industrial processes

    • Novel catalytic activities stable under extreme conditions

    • Structural features that could be engineered into mesophilic proteins

What potential biotechnological applications might emerge from characterizing MJ1489.1?

The characterization of MJ1489.1 may lead to several biotechnological applications:

  • Thermostable enzymes:

    • If enzymatic activity is discovered, potential applications in high-temperature industrial processes

    • Structural elements could be used to engineer thermostability into other proteins

    • Potential applications in PCR and other high-temperature molecular biology techniques

  • Antimicrobial research:

    • Recent research has shown that archaeal proteins can have antimicrobial properties

    • Potential application in developing novel antimicrobials against multidrug-resistant pathogens

    • Structure-function studies could inform antibiotic development strategies

  • Membrane technology:

    • If confirmed as a membrane protein, potential applications in biosensor development

    • Possible use in thermostable membrane protein scaffolds

    • Applications in developing stable membrane systems for biotechnology

  • Protein engineering platforms:

    • Novel structural motifs could be incorporated into protein design

    • Thermostable scaffolds for enzyme engineering

    • Potential for creating hybrid proteins with enhanced stability

What interdisciplinary approaches would be most effective for comprehensive characterization of MJ1489.1?

A comprehensive characterization of MJ1489.1 requires integration of multiple disciplines:

  • Genomics and bioinformatics:

    • Comparative genomics across archaeal species

    • Gene neighborhood analysis and co-expression patterns

    • Evolutionary analysis and phylogenetic profiling

  • Structural biology and biophysics:

    • High-resolution structure determination

    • Dynamics studies under extreme conditions

    • Stability and folding analyses at high temperatures

  • Systems biology:

    • Network analysis of potential interaction partners

    • Integration with metabolomic data from M. jannaschii

    • Computational modeling of archaeal cellular processes

  • Synthetic biology:

    • Heterologous expression systems optimized for archaeal proteins

    • Engineering of chimeric proteins to test domain functions

    • Development of archaeal genetic tools for in vivo studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.