Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1491 (MJ1491)

Shipped with Ice Packs
In Stock

Description

Overview of Methanocaldococcus jannaschii

Methanocaldococcus jannaschii is a hyperthermophilic methanogen discovered in a deep-sea hydrothermal vent . As a deeply rooted archaeon, it thrives in environmental conditions similar to those of early Earth . M. jannaschii obtains energy from hydrogenotrophic methanogenesis, an ancient respiratory metabolism . It also generates entire cells from inorganic nutrients, representing life independent of other living systems .

The genome of M. jannaschii was the first archaeon to be fully sequenced . Analysis of this data revealed novel metabolic features, though a function could not be assigned to 60% of the genes . A genetic system has been developed that allows for the generation of mutants of M. jannaschii for physiological studies and protein purification .

Functional Prediction and Characteristics

The Methanocaldococcus jannaschii Uncharacterized protein MJ1491 (MJ1491) is one of many proteins within the M. jannaschii genome whose function remains unknown . The genome of M. jannaschii contains numerous open reading frames (ORFs), some of which share identities with known sequences while others do not .

Genetic Manipulation and Overexpression

Advancements in genetic tools have allowed for the manipulation of M. jannaschii to overexpress specific proteins . For example, researchers have engineered M. jannaschii to overexpress FprA, a flavin oxidoreductase homolog, using a suicide plasmid and homologous recombination . This approach can be used to study the function of uncharacterized proteins like MJ1491.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MJ1491; Uncharacterized protein MJ1491
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1491
Target Protein Sequence
MKYMVSFDQERMLKPAVIGGIINGILGAICCLCYVIGGAVAAHLYVNAGGICDYENCGLV GAISGVIGGVIASILSFLFMSAYLSALGLKAAMFTGASFIIGFITAIIFGAILGAVGGVI YVVIKNR
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1491

STRING: 243232.MJ_1491

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the basic characteristics of the MJ1491 protein?

MJ1491 is an uncharacterized protein from Methanocaldococcus jannaschii with a full-length sequence consisting of 127 amino acids. It is available as a recombinant protein with a histidine tag and can be expressed in E. coli expression systems . As an uncharacterized protein, its specific biological function remains to be elucidated through targeted research approaches. Understanding its basic properties forms the foundation for more complex functional studies and potential applications in biotechnology.

How does MJ1491 compare to other uncharacterized proteins in archaea?

The comparison requires comprehensive sequence analysis using bioinformatics tools like BLAST, HMM profiling, and phylogenetic analysis. Researchers should align MJ1491 with other archaeal proteins to identify conserved domains and sequence motifs that might suggest functional similarity. Particular attention should be paid to other Methanocaldococcus species proteins to identify genus-specific conservation patterns. This comparative analysis forms the basis for functional prediction and experimental design to characterize the protein.

What expression systems are most effective for recombinant MJ1491 production?

The E. coli expression system has been successfully employed for recombinant MJ1491 production with histidine tags . For optimal expression, researchers should consider using specialized E. coli strains designed for archaeal proteins, such as Rosetta or Arctic Express strains that accommodate rare codons or facilitate proper folding at lower temperatures. Optimization of induction conditions (IPTG concentration, temperature, duration) is critical for maximizing yield while maintaining proper protein folding. Alternative expression systems like yeast or insect cells might be considered if E. coli expression results in insoluble protein.

What methods can be used to determine the structural characteristics of MJ1491?

Multiple complementary approaches should be employed for comprehensive structural characterization:

  • X-ray crystallography: Requires high-purity protein crystallization followed by diffraction pattern analysis.

  • NMR spectroscopy: Particularly useful for analyzing protein dynamics and identifying flexible regions.

  • Cryo-electron microscopy: Appropriate if MJ1491 forms larger complexes with other proteins.

  • Circular dichroism spectroscopy: For initial secondary structure assessment.

  • Computational modeling: Including homology modeling and ab initio approaches when experimental data is limited.

Each method provides unique structural insights, and researchers should select techniques based on specific research questions and available resources.

How can computational approaches predict structural features of MJ1491?

In the absence of experimental structural data, computational methods provide valuable insights:

  • Homology modeling: Identify structural homologs using tools like HHpred, SWISS-MODEL, or I-TASSER, even with low sequence identity.

  • Ab initio modeling: Tools like Rosetta or AlphaFold can predict structures without templates.

  • Secondary structure prediction: Programs such as PSIPRED or JPred can predict α-helices, β-sheets, and coil regions.

  • Disorder prediction: Tools like PONDR or IUPred identify potentially disordered regions.

  • Domain analysis: InterProScan or SMART can identify conserved domains.

Combined computational approaches provide a framework for hypothesis generation and experimental design, though predictions should be validated experimentally.

What experimental approaches are most suitable for functional characterization of uncharacterized proteins like MJ1491?

Functional characterization of uncharacterized proteins requires a multi-faceted approach:

  • Protein interaction studies: Techniques such as pull-down assays, yeast two-hybrid screening, co-immunoprecipitation, and proximity labeling can identify protein-protein interactions .

  • Gene knockout/knockdown: CRISPR-Cas9 or RNAi approaches in model organisms can reveal phenotypic effects.

  • Heterologous expression: Expression in different cell types or organisms to observe functional effects.

  • Biochemical assays: Testing for enzymatic activities such as nuclease, protease, or other catalytic functions.

  • Metabolomic profiling: Identifying metabolic changes when the protein is overexpressed or depleted.

These approaches should be designed hierarchically, moving from broader screening methods to focused functional assays based on initial results.

How can functional analysis methodology from behavioral research be adapted for molecular studies of MJ1491?

While functional analysis (FA) methodology originated in behavioral research, its core principles of controlled comparison between test and control conditions can be adapted for molecular studies:

  • Controlled variable testing: Similar to how FA methodology tests specific environmental variables, molecular studies can systematically test different biochemical conditions or interaction partners to identify functional relationships .

  • Test-control comparisons: Create experimental designs with specific test conditions and appropriate controls, similar to the multielement design in behavioral FA .

  • Single-function testing: When preliminary data suggests a specific function, focus on testing that particular function rather than conducting a comprehensive screen, similar to single-function testing in behavioral FA .

  • Replication and verification: Confirm findings through independent replications using alternative methods, enhancing reliability.

This systematic approach allows for efficient identification of functional properties while maintaining experimental rigor.

How can phylogenetic analysis inform the functional prediction of MJ1491?

Phylogenetic analysis provides evolutionary context essential for functional prediction:

  • Ortholog identification: Identify orthologs across species, particularly focusing on proteins with known functions.

  • Conservation pattern analysis: Highly conserved residues often indicate functional importance.

  • Synteny analysis: Examining genomic context and gene neighborhood can suggest functional associations.

  • Evolutionary rate analysis: Calculating dN/dS ratios to identify selection pressure on specific protein regions.

  • Ancestral sequence reconstruction: Tracing the evolutionary history to identify acquired or lost functions.

The integration of these approaches can reveal functional constraints and evolutionary trajectories that suggest potential biological roles for MJ1491.

What insights can be gained from comparing MJ1491 to proteins from mesophilic organisms?

Comparing MJ1491 to mesophilic homologs can reveal adaptations specific to hyperthermophilic environments:

  • Amino acid composition analysis: Hyperthermophilic proteins often show increased proportions of charged and hydrophobic residues.

  • Structural element comparison: Identifying differences in stabilizing elements like salt bridges, disulfide bonds, and hydrophobic cores.

  • Flexibility assessment: Comparing predicted dynamic properties to identify rigidity adaptations.

  • Functional conservation testing: Determining if mesophilic homologs can complement MJ1491 function and vice versa.

  • Thermal stability comparisons: Experimental measurement of thermal denaturation profiles.

These comparative analyses provide insights into both protein function and thermoadaptation mechanisms.

What are the critical parameters for optimizing recombinant MJ1491 expression?

Optimization of expression conditions is essential for obtaining functional protein:

  • Expression vector selection: Vectors with appropriate promoters, fusion tags, and cleavage sites.

  • E. coli strain selection: Strains like BL21(DE3), Rosetta, or Arctic Express depending on specific requirements .

  • Induction conditions: Optimization of IPTG concentration (0.1-1.0 mM), temperature (15-37°C), and duration (3-24 hours).

  • Media composition: Rich media (LB) versus defined media (M9) depending on downstream applications.

  • Co-expression strategies: Co-expressing chaperones or partner proteins if folding issues arise.

Systematic optimization using factorial design experiments allows efficient identification of optimal conditions.

What purification strategies are most effective for obtaining high-purity MJ1491 for structural studies?

Multi-step purification strategies ensure high purity required for structural studies:

  • Initial capture: His-tag affinity chromatography using Ni-NTA or TALON resins .

  • Intermediate purification: Ion exchange chromatography based on theoretical pI.

  • Polishing step: Size exclusion chromatography to remove aggregates and ensure monodispersity.

  • Tag removal considerations: If tag removal is necessary, optimize protease cleavage conditions and perform reverse affinity chromatography.

  • Quality control assessment: SDS-PAGE, Western blotting, mass spectrometry, and dynamic light scattering to confirm purity and homogeneity.

For thermal stability studies, heat treatment can be incorporated as a purification step, leveraging the thermostable nature of proteins from M. jannaschii.

How can CRISPR-Cas9 technology be applied to study MJ1491 function in vivo?

CRISPR-Cas9 approaches for studying archaeal proteins require specialized strategies:

  • Archaeal CRISPR systems: Adaptation of CRISPR technology for use in archaeal hosts like Thermococcus kodakarensis as a related model organism.

  • Heterologous system design: Creation of surrogate systems in bacteria or yeast expressing MJ1491 for functional screening.

  • Domain-focused mutagenesis: Using CRISPR to create specific point mutations or domain deletions based on computational predictions.

  • CRISPRi approaches: Employing catalytically inactive Cas9 (dCas9) for gene repression studies.

  • High-throughput screening: Combining CRISPR libraries with functional selection.

These approaches bypass limitations of traditional genetic systems in hyperthermophilic archaea while providing functional insights.

What are the most informative biophysical techniques for characterizing MJ1491 thermostability?

Comprehensive thermostability characterization requires multiple biophysical approaches:

  • Differential scanning calorimetry (DSC): For precise melting temperature (Tm) determination and thermodynamic parameters.

  • Circular dichroism thermal melting: To monitor secondary structure changes during thermal denaturation.

  • Intrinsic fluorescence spectroscopy: Tracking tertiary structure changes with temperature.

  • Thermal shift assays: High-throughput screening of stabilizing conditions using fluorescent dyes.

  • Activity assays at different temperatures: Correlating structural stability with functional retention.

Data from these complementary techniques provide insights into the molecular basis of thermostability and potential applications in protein engineering.

How can structural information about MJ1491 inform protein engineering applications?

Structural characterization enables rational protein engineering:

  • Thermostability transfer: Identifying structural elements contributing to thermostability for transfer to mesophilic proteins.

  • Functional enhancement: Structure-guided mutagenesis to improve catalytic properties once function is identified.

  • Interface engineering: Designing protein-protein or protein-ligand interactions based on structural information.

  • Scaffold development: Using the thermostable framework as a scaffold for novel functions.

  • Computational design validation: Using MJ1491 as a model system to validate computational design algorithms for thermostable proteins.

These applications bridge fundamental research with biotechnological innovations, potentially leading to enzymes with enhanced stability for industrial applications.

What collaborative research approaches would accelerate the functional characterization of MJ1491?

Interdisciplinary collaboration significantly enhances characterization efforts:

  • Structural biology and computational modeling: Combining experimental structure determination with prediction methods.

  • Biochemistry and systems biology: Integrating in vitro characterization with cellular network analysis.

  • Evolutionary biology and genomics: Contextualizing functional predictions within evolutionary frameworks.

  • Synthetic biology and protein engineering: Creating chimeric proteins or minimal functional systems.

  • Bioinformatics and machine learning: Developing new algorithms for function prediction from limited data.

Consortium-based approaches pooling expertise and resources across multiple laboratories would accelerate progress in understanding this uncharacterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.