Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1492 (MJ1492)

Shipped with Ice Packs
In Stock

Description

Protein Overview

MJ1492 is encoded by the MJ1492 gene (locus tag) in M. jannaschii, a methanogenic archaeon isolated from deep-sea hydrothermal vents . The protein is classified as "uncharacterized" in UniProt (ID: Q58887) , indicating its role has not yet been experimentally determined. Key attributes include:

PropertyDetails
OrganismMethanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661)
Protein Length156 amino acids (full-length)
Molecular CharacteristicsPredicted transmembrane domains; theoretical molecular weight ~18 kDa
SequenceMKKYYLIVLISFLIFYLSIFLAPYFAYLGETSNFWKFISICLYAVYSLICHQMPQRSFFI... (full sequence in sources)

Production and Purification

Recombinant MJ1492 is typically expressed in E. coli systems and purified using affinity chromatography. Commercial suppliers provide the protein in lyophilized or solution form:

Research Applications

While direct functional studies are lacking, MJ1492’s recombinant form is utilized in:

  • Structural Genomics: As a target for crystallography or NMR to resolve novel protein folds .

  • Antibody Development: Commercial vendors list it as an immunogen for antibody production .

  • Comparative Studies: To explore conserved archaeal protein families and their roles in extremophile adaptation .

Challenges and Future Directions

  • Functional Elucidation: Genetic tools for M. jannaschii (e.g., gene knockouts) developed in 2019 could enable in vivo validation of MJ1492’s role .

  • Biotechnological Potential: Thermostable properties inferred from its archaeal origin may suit industrial applications, pending functional characterization .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specifications.
Synonyms
MJ1492; Uncharacterized protein MJ1492
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1492
Target Protein Sequence
MKKYYLIVLISFLIFYLSIFLAPYFAYLGETSNFWKFISICLYAVYSLICHQMPQRSFFI FGHKMAVCARCFGIYTGVLVGMIIYPFIKKLDDFKIPNKWYLIIALIPMAVDGTTQLIGL RESFNELRFITGFIAGFTVVFYILPIFFEMIYKKFK
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1492

STRING: 243232.MJ_1492

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is currently known about Methanocaldococcus jannaschii Uncharacterized Protein MJ1492?

MJ1492 is a relatively small protein (156 amino acids) from the hyperthermophilic archaeon Methanocaldococcus jannaschii. It is classified as an uncharacterized protein, meaning its precise function has not been fully determined in the organism. The protein can be recombinantly expressed with a His-tag in Escherichia coli expression systems, which facilitates its purification and subsequent analysis . As with many proteins from M. jannaschii, MJ1492 likely possesses thermostable properties given the extreme environment its source organism inhabits.

What expression systems are most effective for producing recombinant MJ1492?

E. coli expression systems have been successfully employed for the recombinant production of MJ1492 . When expressing proteins from hyperthermophiles like M. jannaschii in mesophilic hosts such as E. coli, researchers should consider several factors to optimize expression:

Expression System FactorRecommendation for MJ1492Rationale
E. coli strainBL21(DE3) or derivativesReduced protease activity, T7 RNA polymerase expression
Expression vectorpET system with His-tagFacilitates purification and detection
Codon optimizationConsider rare codon supplementationM. jannaschii uses different codon preferences than E. coli
Induction conditionsLower temperatures (15-25°C)May improve folding of archaeal proteins
Media supplementsRare tRNA plasmids (e.g., pRI952)Accommodates codons rare in E. coli

Similar to other M. jannaschii proteins, careful consideration of codon usage is important, as researchers working with other M. jannaschii proteins have incorporated rare tRNA genes (argU and ileX) to accommodate codons that are rare in E. coli .

What purification strategies should be employed for recombinant MJ1492?

The recommended purification strategy for His-tagged recombinant MJ1492 would involve:

  • Initial cell lysis using appropriate buffer systems (e.g., 50 mM Tris pH 7.5-8.0, 10% glycerol, reducing agents like DTT)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar matrices

  • Size exclusion chromatography to ensure homogeneity

  • Optional heat treatment step (65-80°C) to exploit the thermostability advantage and remove E. coli contaminants

For M. jannaschii proteins, buffer systems similar to those used for other archaeal proteins would be appropriate, such as those containing 50 mM Tris (pH 7.5), 10% glycerol, 1 mM EDTA, 5 mM DTT, and potentially ammonium sulfate .

What experimental approaches are most effective for functional characterization of MJ1492?

Functional characterization of uncharacterized proteins like MJ1492 requires a multi-faceted approach:

ApproachMethodologyExpected Insights
Comparative genomicsBioinformatic analysis of homologs and conserved domainsPotential evolutionary relationships and functional hints
Transcriptional contextAnalysis of genomic neighborhood and co-expression patternsPotential functional pathways or interactions
Structural biologyX-ray crystallography, NMR, or cryo-EMStructural features suggesting function
Protein-protein interactionsPull-down assays, yeast two-hybrid, crosslinking studiesIdentifying binding partners that suggest function
Biochemical assaysSubstrate screening, enzyme activity testsDirect functional determination
Gene knockout/knockdownCRISPR-Cas9 in related speciesPhenotypic effects revealing function

For archaeal proteins like MJ1492, it's particularly important to consider thermophilic conditions in biochemical assays, as the optimal temperature for activity is likely to be much higher than standard laboratory conditions, potentially in the range of 85-90°C given M. jannaschii's optimal growth temperature.

How can structural biology techniques be optimized for thermostable proteins like MJ1492?

Structural studies of thermostable proteins like MJ1492 require specific considerations:

  • X-ray crystallography: Thermostable proteins often crystallize more readily due to their intrinsic stability. Crystal trials for MJ1492 should include:

    • Buffer systems stable at high temperatures

    • Inclusion of specific ions that might be relevant to the archaeal cellular environment

    • Consideration of potential cofactors or binding partners

  • Nuclear magnetic resonance (NMR): For a 156-amino acid protein like MJ1492, NMR could provide valuable structural information:

    • Isotopic labeling (15N, 13C) would be required

    • Study of temperature-dependent structural changes could provide insights into thermostability mechanisms

    • NMR relaxation studies could reveal dynamic regions relevant to function

  • Cryo-electron microscopy (cryo-EM): If MJ1492 forms larger complexes or assemblies, cryo-EM approaches might be valuable.

Similar approaches have been successfully applied to DEAD box proteins from M. jannaschii, yielding important structural insights into protein function in hyperthermophiles .

What computational methods can help predict the potential function of MJ1492?

Computational MethodApplication to MJ1492Potential Insights
Homology modelingStructure prediction based on related proteinsStructural features and potential active sites
Molecular dynamics simulationsBehavior at high temperaturesThermostability mechanisms
Binding site predictionIdentification of potential ligand pocketsSubstrate specificity and function
Phylogenetic analysisEvolutionary relationships with characterized proteinsFunctional conservation
Protein-protein interaction predictionPotential interaction partnersFunctional pathways
Machine learning approachesFunction prediction from sequence/structureNovel functional hypotheses

These computational approaches should be integrated with experimental data for maximum effectiveness in characterizing MJ1492.

How should researchers design in vitro transcription experiments involving M. jannaschii proteins?

In vitro transcription experiments with M. jannaschii proteins require specialized conditions due to their thermophilic nature:

  • Temperature considerations: Experimental temperatures should be significantly higher than those used for mesophilic systems, typically ranging from 65°C to 85°C .

  • Buffer optimization: Standard buffers used for in vitro transcription may need modification:

    • Higher concentration of stabilizing agents (glycerol, betaine)

    • Thermostable buffer components that maintain pH at high temperatures

    • Addition of specific ions found in the archaeal cellular environment

  • Enzyme and component stability: All components must be stable at high temperatures:

    • Purified recombinant RNA polymerase components from M. jannaschii

    • Thermostable general transcription factors

    • DNA templates designed to remain stable at elevated temperatures

  • Data collection and analysis:

    • Time courses may differ from mesophilic systems

    • Product stability and degradation should be monitored at high temperatures

    • Control experiments at both standard and elevated temperatures are essential

The fully recombinant M. jannaschii RNA polymerase system allows detailed dissection of the different stages of transcription, providing a valuable model for understanding thermophilic transcription processes .

What experimental design principles should be applied when studying biochemical properties of MJ1492?

Effective experimental design for studying MJ1492 should incorporate factorial design principles to systematically explore key variables:

FactorLevels to ConsiderMeasurement Parameters
Temperature65°C, 75°C, 85°C, 95°CActivity, stability, conformation
pH5.0, 6.0, 7.0, 8.0, 9.0Optimal function, structural changes
Salt concentrationLow, medium, highStability, activity, oligomerization
Potential cofactorsVarious metal ions, organic cofactorsActivation or inhibition effects
Reducing conditionsVarious DTT or β-mercaptoethanol concentrationsEffect on disulfide bonds and activity

Principal Component Analysis (PCA) can be valuable for analyzing multifactorial experimental data, helping identify the most significant parameters affecting protein function. This approach allows researchers to visualize relationships between variables and identify patterns in complex datasets .

The experimental design should include appropriate controls and sufficient replicates to ensure statistical validity, with measurements taken at multiple time points to capture temporal effects on protein behavior.

How can researchers effectively compare data across different experimental conditions when studying thermostable proteins?

When comparing experimental data for thermostable proteins like MJ1492 across different conditions:

  • Normalization strategies:

    • Normalize activity measurements relative to optimal conditions

    • Use standard reference proteins for comparison

    • Develop temperature-corrected metrics for direct comparison with mesophilic counterparts

  • Statistical analysis approaches:

    • Apply analysis of variance (ANOVA) to determine significant effects of experimental factors

    • Use multi-way comparisons with appropriate post-hoc tests

    • Implement regression models to quantify relationships between variables

  • Data visualization techniques:

    • Create factor trajectories to track changes over time or conditions

    • Use correlation circles to visualize relationships between measured parameters

    • Develop heat maps to represent multidimensional data

  • Integrated analysis:

    • Combine biochemical, structural, and computational data

    • Apply machine learning approaches to identify patterns

    • Use meta-analysis techniques to compare with other thermostable proteins

These approaches have been successfully applied in experimental designs studying material degradation over time , and similar principles can be applied to protein stability and function studies.

What analytical methods are most appropriate for monitoring the stability and activity of MJ1492 at high temperatures?

Analytical MethodApplication to MJ1492Temperature Considerations
Differential scanning calorimetry (DSC)Thermal denaturation profilesCan measure up to 130°C, ideal for thermostable proteins
Circular dichroism (CD) spectroscopySecondary structure changes with temperatureMay require specialized high-temperature cells
Intrinsic fluorescenceTertiary structure changesTemperature control and correction for temperature effects needed
Dynamic light scattering (DLS)Aggregation state at different temperaturesHigh-temperature compatible instruments required
Activity assaysFunctional characterizationThermostable substrates and detection methods needed
Thermofluor/DSF assaysThermal stability screeningModified protocols for proteins with very high melting temperatures

Researchers should ensure that all equipment and reagents can withstand the high temperatures required for studying thermostable proteins from M. jannaschii, which typically exhibits optimal growth at around 85°C.

How should researchers approach the challenge of identifying potential binding partners or substrates for an uncharacterized protein like MJ1492?

Identifying binding partners or substrates for uncharacterized proteins requires a multi-faceted approach:

  • Genomic context analysis:

    • Examine genes adjacent to MJ1492 in the M. jannaschii genome

    • Identify potentially co-regulated genes or operons

    • Search for conserved genomic neighborhoods in related species

  • Pull-down and co-immunoprecipitation experiments:

    • Use recombinant His-tagged MJ1492 as bait

    • Perform experiments at physiologically relevant temperatures

    • Analyze captured proteins using mass spectrometry

  • Substrate screening approaches:

    • Activity-based protein profiling

    • Metabolite screening using NMR or mass spectrometry

    • Small molecule library screening with thermal shift assays

  • Cross-linking studies:

    • Use thermostable cross-linking reagents

    • Perform in vivo cross-linking in related archaeal species

    • Analyze cross-linked complexes with mass spectrometry

  • Surface plasmon resonance or bio-layer interferometry:

    • Screen potential binding partners at various temperatures

    • Evaluate binding kinetics and thermodynamics

    • Test stability of interactions under different conditions

For each approach, controls using unrelated proteins from M. jannaschii should be included to distinguish specific from non-specific interactions.

How can phylogenetic analysis help identify the potential function of MJ1492?

Phylogenetic analysis provides valuable insights into protein function through evolutionary relationships:

  • Sequence homology searches:

    • BLAST searches against characterized protein databases

    • Profile-based searches using PSI-BLAST or HMMer

    • Domain-specific searches using conserved domain databases

  • Multiple sequence alignment analysis:

    • Identification of conserved residues suggesting functional importance

    • Detection of sequence motifs associated with specific functions

    • Analysis of co-evolving residues suggesting structural or functional relationships

  • Phylogenetic tree construction:

    • Maximum likelihood or Bayesian methods for accurate tree inference

    • Reconciliation of gene and species trees to identify duplication/horizontal transfer events

    • Character state reconstruction to trace functional evolution

  • Comparative genomics:

    • Analysis of gene neighborhood conservation

    • Detection of fusion proteins providing functional clues

    • Identification of co-occurrence patterns suggesting functional relationships

This approach has been successful in characterizing the function of previously uncharacterized proteins in archaea, including those from extremophiles like M. jannaschii.

What special considerations should be taken when comparing MJ1492 with homologous proteins from mesophilic organisms?

When comparing proteins from hyperthermophiles like M. jannaschii with mesophilic counterparts:

Comparative AspectSpecial ConsiderationsAnalysis Approach
Sequence compositionHigher GC content in coding regions, different amino acid preferencesCompositional bias correction in alignments and phylogenetic analyses
Structural featuresAdditional stabilizing interactions, more compact foldingComparative structural modeling with temperature-specific parameters
Domain architecturePotential unique domains or adaptationsDomain-specific alignments and structural comparisons
Substrate specificityPotentially broader or narrower substrate rangeComparative biochemical characterization at relevant temperatures
Cofactor requirementsDifferent metal ion preferences or binding modesSystematic testing of various cofactors at different temperatures
Catalytic parametersDifferent optimal conditions for activityTemperature-corrected kinetic comparisons

Researchers should be cautious about inferring function based solely on sequence similarity, as thermophilic adaptations can significantly alter protein properties even when core functions are conserved.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.