Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1506 (MJ1506)

Shipped with Ice Packs
In Stock

Description

General Context of Uncharacterized Proteins in Methanocaldococcus jannaschii

M. jannaschii was the first archaeon to have its genome sequenced (1996), revealing many uncharacterized genes . Over 60% of its genes lacked functional assignments initially, with subsequent reannotation efforts still leaving ~33% uncharacterized . Uncharacterized proteins like MJ1506 are common in methanogens due to their unique metabolic pathways and extremophilic lifestyles.

Key challenges include:

  • Limited experimental validation for predicted functions.

  • High sequence divergence from eukaryotic/bacterial homologs.

  • Specialized biochemical roles in methanogenesis or thermoadaptation.

Recombinant Protein Production in M. jannaschii

While MJ1506 is not explicitly described, recombinant protein production in M. jannaschii has been demonstrated for other uncharacterized proteins (e.g., MJ1509). Below is a comparison of known recombinant proteins in M. jannaschii:

ProteinUniProt IDFunctionExpression SystemKey Findings
MJ1509Q58904UncharacterizedE. coli>85% purity (SDS-PAGE); sequence: MAEMIIPYPQLKKIMKTTCEIDLYKTEAEDIMDVVEKKLA...
MJ0570Not listedDiphthamide synthase (EC 6.3.1.14)E. coli30% identity to yeast diphthine-ammonia ligase; completes diphthamide biosynthesis.
FprANot listedF420H2-dependent sulfite reductaseNative M. jannaschiiHigh oxygen reduction activity (2,100 μmol/min/mg at 70°C).

MJ1506 Status:

  • No experimental data, sequence alignments, or functional predictions are available in the provided sources.

  • Likely belongs to the ~33% of M. jannaschii genes with unknown roles .

Hypotheses for MJ1506’s Function

Based on M. jannaschii’s metabolic landscape, potential roles include:

Hypothesized RoleRationaleSupporting Evidence
MethanogenesisParticipation in cofactor biosynthesis (e.g., F430, F420) or methane production.M. jannaschii relies on unique cofactors; MJ0879 (factor 430 biosynthesis) had misannotations .
ThermoadaptationChaperone or protease activity to manage protein stability at 94°C.The 20S proteasome and PAN ATPase complex are critical for protein degradation .
Redox RegulationInvolvement in hydrogenases or electron transfer chains.M. jannaschii encodes multiple hydrogenases (e.g., eha, F420 hydrogenase) .

Research Gaps and Future Directions

  1. Experimental Validation:

    • Heterologous Expression: Recombinant MJ1506 could be expressed in E. coli or archaeal systems (e.g., M. marburgensis) to test enzyme activity .

    • Cofactor Dependency: Screen for interactions with F420, F430, or other methanogen-specific cofactors.

  2. Bioinformatics:

    • Phylogenetic Analysis: Compare MJ1506 to archaeal homologs to infer evolutionary conservation.

    • Structural Prediction: Use tools like AlphaFold to predict tertiary structure and binding sites.

  3. Genetic Tools:

    • Gene Knockout: Use M. jannaschii’s recently developed genetic system to study phenotypic effects of MJ1506 deletion.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
MJ1506; Uncharacterized protein MJ1506
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-437
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1506
Target Protein Sequence
MLYILKCKSNYIINFHRLPQKTSKALYTNISLSFIYRFMWGIMMKKLLIILIGFILLSSI SAIQIDAPQYQPNVIHPGDDVDLWIKINNDNYDNEVKNIVVEVTPHYPFELRQVNPIKGK ATISHLNPGESDTVYFKLHVDENAPSRDYRIDVKVSYDEVDKEDGKETSHHYEITKIYYL HVYGIASFEINIDDTSIIPGKTKTIKLDIKNVGTGNAKYLNLYLIGNDKINILGGSLIFV GCLKANNQYIIPIKIYAVPEIEDGIYSINANLFWVGEDGKQYNSTIPLNIRVVKKIYANQ PYIYLDDVKNKGDYIEITIGIANRGTTKIKHCVMTLTANGRNYTKYIGDLDEDDYDTSIF EIKEFGDIPIKVTVTYFDDYHNPYNATETFNIHVEKVKKEESLSPMYIIGGVIVVIIIIL YIRKRKRHQEFEEFEEI
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1506

STRING: 243232.MJ_1506

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii MJ1506 protein and why is it significant to study?

MJ1506 is an uncharacterized protein from Methanocaldococcus jannaschii, a hyperthermophilic methanogenic archaeon originally isolated from a deep-sea "white smoker" chimney at a depth of 2600m in the East Pacific Rise. This organism thrives in extreme conditions, including temperatures of 48-94°C (optimal growth at 85°C) and pressures up to 500 atmospheres . The MJ1506 protein consists of 437 amino acids, and its function remains unknown despite the complete genome sequencing of M. jannaschii .

Studying uncharacterized proteins like MJ1506 is significant for several reasons:

  • They may represent novel biochemical functions or structural motifs

  • They provide insight into archaeal biology and extreme environment adaptations

  • Their characterization contributes to our understanding of protein evolution

  • They may possess properties valuable for biotechnological applications due to their thermostability

How is recombinant MJ1506 protein typically expressed and purified?

The recombinant MJ1506 protein is typically expressed with an N-terminal His-tag in E. coli expression systems . The full expression and purification protocol includes:

  • Cloning the full-length MJ1506 gene (encoding amino acids 1-437) into a suitable expression vector

  • Transformation into E. coli expression strains

  • Induction of protein expression under optimized conditions

  • Cell lysis and initial purification using nickel affinity chromatography (leveraging the His-tag)

  • Further purification steps may include size exclusion chromatography or ion exchange chromatography

  • The purified protein is typically provided as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0

For reconstitution, it is recommended to:

  • Centrifuge the vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol (recommended final concentration 50%) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

What approaches are recommended for functional characterization of uncharacterized proteins like MJ1506?

Functional characterization of uncharacterized archaeal proteins requires a multi-faceted approach:

  • Bioinformatic Analysis:

    • Sequence homology searches across diverse databases

    • Motif identification and domain prediction

    • Gene neighborhood analysis within the M. jannaschii genome

    • Structural prediction and threading against known protein folds

  • Experimental Approaches:

    • Protein-protein interaction studies (pull-down assays, yeast two-hybrid)

    • Substrate screening using metabolite libraries

    • Activity assays based on predicted biochemical functions

    • Knockout/knockdown studies in archaeal model systems when available

    • Heterologous expression followed by phenotypic analysis

  • Structural Biology:

    • Crystallization trials under various conditions

    • NMR spectroscopy for smaller domains

    • Cryo-EM for larger complexes

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

For MJ1506 specifically, the presence of potential transmembrane regions suggests possible roles in membrane transport, signaling, or structural organization. Lipid binding assays and membrane reconstitution experiments would be particularly relevant for functional characterization.

How should researchers design experiments to study extremophilic proteins like MJ1506 under native-like conditions?

When studying extremophilic proteins like MJ1506 from a hyperthermophilic archaeon, experimental design should account for the protein's native environment:

Temperature Considerations:

  • Conduct enzymatic or binding assays at elevated temperatures (60-85°C)

  • Use temperature-controlled spectrophotometers or calorimeters

  • Include thermostable buffers that maintain pH at high temperatures

  • Compare activity profiles across temperature ranges (20-95°C)

Pressure Variables:

  • When relevant, utilize high-pressure chambers for enzymatic assays

  • Consider pressure effects on protein structure and function

  • Implement pressure-resistant equipment for accurate measurements

Buffer and Salt Conditions:

  • Test activity in buffers mimicking intracellular ionic strength of M. jannaschii

  • Evaluate the effect of salt concentration on protein stability and activity

  • Include stabilizing agents like glycerol or trehalose during extended assays

Anaerobic Requirements:

  • Conduct experiments in anaerobic chambers when necessary

  • Use oxygen-scavenging systems for sensitive assays

  • Monitor oxygen levels throughout experimental procedures

Experimental Design Table:

ParameterNative ConditionLaboratory AdaptationMeasurement Tools
Temperature85°C (optimal)Gradient 60-90°CThermostable spectrophotometer
PressureUp to 500 atmAtmospheric with pressure modulesHigh-pressure reaction vessels
OxygenStrict anaerobeAnaerobic chamber, reducing agentsOxygen sensors, resazurin indicators
pHNeutral-slightly acidicpH 6.0-7.5 with temperature compensationpH probes rated for high temperature
SalinityHigh salt0.5-2.0 M NaCl/KCl gradientsConductivity meters

What comparative genomics approaches would be valuable for understanding MJ1506 in the context of archaeal evolution?

To understand MJ1506 in the evolutionary context of archaea, several comparative genomics approaches are recommended:

  • Ortholog Identification:

    • Search for MJ1506 homologs across archaeal, bacterial, and eukaryotic genomes

    • Create phylogenetic profiles to determine the distribution pattern

    • Identify species-specific adaptations through sequence comparison

  • Synteny Analysis:

    • Examine the genomic context of MJ1506 and its orthologs

    • Identify conserved gene clusters that may indicate functional relationships

    • Compare operon structures across related archaeal species

  • Evolutionary Rate Analysis:

    • Calculate selection pressures (dN/dS ratios) across different lineages

    • Identify rapidly evolving or highly conserved regions within the protein

    • Perform site-specific evolutionary analysis to detect functionally important residues

  • Domain Architecture Comparison:

    • Map domain organization changes across evolutionary time

    • Identify fusion events, domain shuffling, or domain loss/gain

    • Correlate domain architecture with habitat and lifestyle adaptations

  • Horizontal Gene Transfer (HGT) Assessment:

    • Evaluate whether MJ1506 shows evidence of HGT through phylogenetic incongruence

    • Examine nucleotide composition and codon usage patterns

    • Determine if the gene was acquired from bacteria or other archaea

The complete 1.66-megabase genome sequence of M. jannaschii provides an excellent foundation for these analyses . Researchers should leverage this genomic data alongside the 1738 predicted protein-coding genes to build comprehensive evolutionary models for MJ1506.

What are the challenges and solutions in expressing archaeal membrane proteins like MJ1506 in heterologous systems?

Based on sequence analysis, MJ1506 may contain transmembrane regions, presenting specific challenges for heterologous expression:

Challenges and Solutions:

  • Membrane Protein Toxicity:

    • Challenge: Overexpression often leads to toxicity in E. coli

    • Solution: Use tightly regulated inducible promoters (e.g., PBAD), lower induction temperatures (16-20°C), and specialized E. coli strains (C41, C43)

  • Protein Misfolding:

    • Challenge: Different membrane environments between archaea and expression hosts

    • Solution: Co-express archaeal chaperones, add specific lipids to growth media, use cell-free expression systems with archaeal lipid nanodiscs

  • Codon Usage Bias:

    • Challenge: Archaeal codon preferences differ from E. coli

    • Solution: Optimize codons for expression host or use specialized strains with rare tRNAs

  • Post-translational Modifications:

    • Challenge: Archaeal PTMs may differ from bacterial systems

    • Solution: Consider eukaryotic expression systems or archaeal hosts when specific modifications are critical

  • Protein Extraction and Purification:

    • Challenge: Extracting membrane proteins without denaturation

    • Solution: Use specialized detergents (DDM, LMNG), amphipols, or nanodiscs; implement mild solubilization conditions

  • Thermal Stability Assessment:

    • Challenge: Maintaining stability of thermophilic proteins at lower temperatures

    • Solution: Include stabilizing agents (glycerol, specific ions); evaluate stability through thermal shift assays

Expression Strategy Comparison:

Expression SystemAdvantagesDisadvantagesRecommended for MJ1506?
E. coliHigh yield, simple geneticsMembrane differences, inclusion body formationYes, with optimization
Yeast (P. pastoris)Eukaryotic folding, scalableLonger expression time, glycosylation differencesPossible alternative
Insect cellsComplex protein handlingExpensive, time-consumingNot first choice
Cell-free systemsRapid, directly incorporates detergents/lipidsLower yield, expensiveExcellent for troubleshooting
Archaeal hostsNative environmentChallenging genetics, low yieldsResearch tool for verification

What are the optimal storage and handling conditions for maintaining the activity of recombinant MJ1506 protein?

To maintain the activity and stability of recombinant MJ1506 protein, implement the following storage and handling protocols:

Storage Recommendations:

  • Store lyophilized protein at -20°C to -80°C upon receipt

  • After reconstitution, add glycerol to a final concentration of 50%

  • Aliquot into small volumes to prevent repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage, keep at -80°C in tightly sealed containers

Handling Guidelines:

  • Briefly centrifuge vials before opening to collect material at the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Handle all solutions under sterile conditions

  • When working with thermostable proteins, consider temperature during experimental procedures

  • Avoid repeated freeze-thaw cycles which can lead to denaturation and aggregation

Buffer Considerations:

  • The protein is supplied in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • For functional studies, evaluate protein stability in various buffers (PIPES, HEPES, phosphate)

  • Consider the addition of reducing agents if the protein contains cysteines

  • For membrane proteins, include appropriate detergents at concentrations above their critical micelle concentration (CMC)

Activity Preservation:

  • Conduct activity assays immediately after thawing when possible

  • Monitor protein stability through size exclusion chromatography or dynamic light scattering

  • Consider flash-freezing in liquid nitrogen instead of slow freezing in -20°C freezers

What experimental controls should be included when characterizing an uncharacterized protein like MJ1506?

Negative Controls:

  • Buffer-only controls in all enzymatic and binding assays

  • Empty vector-transformed host cells for expression studies

  • Denatured protein samples for structure-dependent activities

  • Non-specific proteins of similar size/characteristics for binding studies

  • Substrate analogs or inhibitors for validating catalytic activities

Positive Controls:

  • Well-characterized proteins with related predicted functions

  • Known substrates for enzymatic assay development

  • Verified interaction partners for binding studies

  • Standard proteins for thermostability comparisons

Technical Controls:

  • Multiple protein preparations to ensure reproducibility

  • Batch validation through activity assays or biophysical characterization

  • Time-course experiments to assess protein stability during assays

  • Concentration gradients to establish dose-dependent effects

Specificity Controls:

  • Site-directed mutants targeting predicted catalytic residues

  • Domain deletion constructs to map functional regions

  • Competitive inhibition assays to confirm binding specificity

  • Cross-species comparison with homologous proteins when available

Control Implementation Table:

Experimental ApproachEssential ControlsPurpose
Enzyme activity screeningBoiled enzyme, no-enzyme reactionsDistinguish enzymatic from non-enzymatic reactions
Protein-protein interactionsGST-only/His-only baits, non-specific proteinsIdentify false positives from tag or non-specific binding
Thermal stability assaysKnown thermostable and mesophilic proteinsBenchmark relative stability
Substrate binding studiesStructurally related non-substratesConfirm binding specificity
Localization studiesEmpty vector, known localization markersValidate cellular compartment targeting

How can researchers integrate structural and functional data to propose mechanisms for uncharacterized proteins like MJ1506?

Integrating structural and functional data requires a methodical approach to generate testable hypotheses about MJ1506's function:

Step-by-Step Integration Process:

  • Primary Structure Analysis:

    • Identify conserved motifs and functional residues through multiple sequence alignments

    • Map conservation patterns onto predicted secondary structure elements

    • Utilize tools like ConSurf to visualize evolutionary conservation

  • Secondary and Tertiary Structure Prediction:

    • Generate structure predictions using tools like AlphaFold2 or RoseTTAFold

    • Identify potential active sites or binding pockets

    • Compare predicted structures to known folds in the PDB

  • Experimental Structure Validation:

    • Perform limited proteolysis to identify domain boundaries

    • Use circular dichroism to confirm secondary structure elements

    • Validate predicted structures through mutation of key residues

  • Functional Mapping:

    • Conduct site-directed mutagenesis of predicted functional residues

    • Test substrate specificity with structural analogs

    • Create truncation constructs to map minimal functional domains

  • Molecular Dynamics Simulations:

    • Simulate protein behavior at archaeal physiological conditions

    • Analyze conformational flexibility and potential allosteric sites

    • Model potential substrate interactions in silico

  • Mechanism Hypothesis Development:

    • Integrate all data into coherent mechanistic models

    • Design experiments to specifically test mechanism hypotheses

    • Refine models based on experimental feedback

Data Integration Matrix:

Data TypeContribution to MechanismValidation Method
Sequence conservationIdentifies functionally important residuesMutagenesis, functional assays
Structure predictionProvides framework for mechanistic modelBiophysical characterization, SAXS
Binding assaysDefines substrates and interaction partnersCompetition assays, ITC
Catalytic assaysEstablishes biochemical functionEnzyme kinetics, inhibition studies
Cellular studiesPlaces function in biological contextComplementation, localization

What analytical techniques are most appropriate for studying the biochemical properties of extremophilic proteins like MJ1506?

Extremophilic proteins require specialized analytical techniques that account for their unique properties:

Thermal Stability Analysis:

  • Differential Scanning Calorimetry (DSC):

    • Measures heat capacity changes during protein unfolding

    • Can analyze samples at temperatures up to 130°C

    • Provides thermodynamic parameters (ΔH, ΔS, ΔG)

  • Circular Dichroism (CD) with Temperature Control:

    • Monitors secondary structure changes during thermal denaturation

    • Equipment must be capable of high-temperature measurements

    • Provides melting temperature (Tm) and unfolding transitions

  • Thermal Shift Assays (Thermofluor):

    • High-throughput screening for stabilizing conditions

    • Uses fluorescent dyes that bind to hydrophobic regions exposed during unfolding

    • Particularly useful for buffer optimization

Functional Characterization:

  • High-Temperature Enzyme Kinetics:

    • Specialized equipment with temperature-controlled reaction chambers

    • Real-time monitoring of substrate conversion

    • Arrhenius plot analysis to determine activation energy

  • Isothermal Titration Calorimetry (ITC):

    • Direct measurement of binding thermodynamics

    • Temperature-controlled systems for high-temperature measurements

    • Determines enthalpy, entropy, and binding constants

  • Surface Plasmon Resonance (SPR):

    • Real-time binding analysis

    • High-temperature fluidics systems available

    • Determines association and dissociation kinetics

Structural Analysis:

  • X-ray Crystallography:

    • Gold standard for high-resolution structures

    • May require specialized crystallization conditions for extremophilic proteins

    • Crystal harvesting and data collection at room temperature may affect native state

  • Nuclear Magnetic Resonance (NMR):

    • Can perform experiments at elevated temperatures

    • Provides dynamic information in solution

    • Size limitations may restrict application to domains rather than full-length proteins

  • Cryo-Electron Microscopy:

    • Preserves native conformation through vitrification

    • Suitable for large complexes or membrane proteins

    • Recent advances allow near-atomic resolution

Comparative Method Evaluation:

Analytical MethodTemperature RangeSample RequirementsInformation GainedLimitations for MJ1506
DSCUp to 130°C0.5-1.0 mg proteinUnfolding thermodynamicsRequires pure protein
CDUp to 95°C0.1-0.2 mg proteinSecondary structure changesLess sensitive at high temperatures
ITCUp to 80°C1-2 mg proteinBinding thermodynamicsBuffer matching critical
HDX-MSUp to 70°C0.1-0.5 mg proteinConformational dynamicsRequires specialized equipment
Activity assaysUp to 100°CDepends on assayFunctional parametersSubstrate stability at high temperatures

How can researchers design experiments to detect potential enzymatic activities of uncharacterized proteins like MJ1506?

Systematically investigating potential enzymatic activities requires a structured experimental approach:

Activity Screening Strategies:

  • Sequence-Based Predictions:

    • Analyze for catalytic triads or metal-binding motifs

    • Look for substrate-binding pockets in structural models

    • Search for distant homology to characterized enzymes

  • Class-Specific Activity Screening:

    • Test for hydrolase activities using fluorogenic substrates

    • Screen for kinase activity with ATP and potential substrates

    • Assess oxidoreductase functions with appropriate cofactors

  • Metabolite Profiling:

    • Incubate protein with cellular extracts and analyze by LC-MS

    • Monitor changes in metabolite profiles compared to control

    • Identify potential substrate-product relationships

  • Activity-Based Protein Profiling:

    • Use chemical probes designed for specific enzyme classes

    • Look for probe modification of the target protein

    • Identify reactive residues through mass spectrometry

Experimental Design Matrix:

Activity ClassScreening MethodDetection SystemControls
HydrolasesFluorogenic substrates (AMC, pNA derivatives)Fluorescence/absorbanceNo enzyme, heat-inactivated enzyme
TransferasesDonor-acceptor pairs with detection of productHPLC, coupled assaysIndividual components, non-related protein
OxidoreductasesNAD(P)H/NAD(P)+ conversionAbsorbance at 340nmNo substrate, no cofactor
LyasesSubstrate disappearance or product formationSpectrophotometricChemically catalyzed reaction
IsomerasesSubstrate-product equilibriumNMR, chromatographyEquilibrium without enzyme
LigasesATP consumption, AMP/ADP formationLuminescence, coupled assaysNo substrate, ATP only

High-Throughput Approach:

  • Design a 96-well format screening platform with different substrate classes

  • Include appropriate buffer systems that maintain stability at high temperatures

  • Implement positive and negative controls in each plate

  • Use automated liquid handling for consistency and throughput

  • Employ data analysis tools to identify hits and eliminate false positives

For archaeal proteins like MJ1506, always consider conducting assays at elevated temperatures that reflect their native environment (60-85°C) alongside standard temperature conditions.

How can structural data from MJ1506 contribute to our understanding of protein adaptation to extreme environments?

Structural analysis of MJ1506 provides valuable insights into archaeal protein adaptations to extreme conditions:

Thermostability Mechanisms:

  • Analyze amino acid composition for increased prevalence of charged residues forming ionic networks

  • Identify hydrophobic core packing that may contribute to stability

  • Map potential disulfide bonds or metal coordination sites

  • Evaluate helix capping and secondary structure stabilization strategies

Comparative Structural Analysis:

  • Compare MJ1506 structure with mesophilic homologs when available

  • Identify unique structural elements that may confer thermostability

  • Analyze flexibility and rigidity patterns across different temperature adaptations

  • Use molecular dynamics simulations to assess structural behaviors at different temperatures

Adaptation Principles Extraction:

  • Determine general principles of thermoadaptation applicable to protein engineering

  • Identify minimal mutations needed to confer thermostability to mesophilic proteins

  • Assess trade-offs between structural rigidity and functional flexibility

  • Generate predictive models for protein stability at extreme temperatures

The patent information indicates that M. jannaschii was isolated from a deep-sea hydrothermal vent environment with temperatures ranging from 48-94°C and pressures up to 500 atmospheres . Structural adaptations in MJ1506 may reflect these extreme conditions and provide generalizable principles for protein engineering and synthetic biology applications.

What experimental approaches would you recommend for determining if MJ1506 forms complexes with other proteins?

To investigate protein-protein interactions involving MJ1506, several complementary approaches should be employed:

In Vitro Interaction Methods:

  • Pull-Down Assays:

    • Express MJ1506 with affinity tags (His, GST)

    • Incubate with M. jannaschii lysate or recombinant candidates

    • Analyze captured proteins by mass spectrometry

    • Confirm interactions with specific antibodies when available

  • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS):

    • Determine native molecular weight and stoichiometry

    • Assess complex formation under different buffer conditions

    • Evaluate temperature dependence of complex formation

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

    • Immobilize MJ1506 on sensor chips/tips

    • Flow potential interaction partners at different concentrations

    • Determine binding kinetics and affinities

    • Test stability of complexes at elevated temperatures

  • Microscale Thermophoresis (MST):

    • Label MJ1506 with fluorescent dye

    • Mix with potential interaction partners

    • Measure thermophoretic movement changes upon binding

    • Particularly useful for membrane protein interactions

Structural Methods for Complex Characterization:

  • Cryo-Electron Microscopy:

    • Visualize complexes at near-atomic resolution

    • Determine three-dimensional architecture

    • Map interaction interfaces

  • Cross-linking Mass Spectrometry (XL-MS):

    • Chemically cross-link protein complexes

    • Digest and analyze by mass spectrometry

    • Identify residues in close proximity at interfaces

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Compare exchange rates of free protein vs. complex

    • Identify regions protected upon complex formation

    • Works well for dynamic or transient interactions

Computational Prediction and Validation:

  • Protein-Protein Docking:

    • Generate models of potential complexes

    • Evaluate interface energetics and complementarity

    • Design mutations to disrupt predicted interfaces

  • Coevolution Analysis:

    • Identify co-evolving residue pairs across multiple species

    • Predict interaction interfaces based on evolutionary constraints

    • Guide experimental validation through targeted mutations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.